Class 9
Scientific apparatus and instrumentsother than for medical useelectronic smart meters for measuring electricitygaswaterheat; control box for electronic smart meters; electric couplings; electric accumulators; apparatus for accumulation and storage of electricityelectric accumulators; wireless electronic controllers to remotely monitor and control the functioning of alarms; sound amplifying apparatusconnected speakers; audiovisual teaching apparatusaudiovisual receivers; data processing apparatus and instruments; anti-theft devicestheft alarmselectric warning lightselectronic warning bells; fire warning apparatusfire alarms; cablesoptical fiber cablesconnectors and cordselectric cable; video cameras; infrared cameras; integrated circuit cards; circuit breakers; printed circuits; electronic integrated circuits; computer keyboards; Power switches; computer switches; automatic switchboards; electric apparatus for switching; semi-conductors; material for electricity mainsjunction boxes; electric connections; electric contacts; electric current regulating apparatus; electric converters; energy convertersapparatus for calculatingsumming and determining increments of energy volume; direct/alternating current static converters; static regulation and disconnecting equipment and apparatus for electrical networksinternal disconnection systems such as power cut off relays; differential insulation-fault detectors in direct current networks; dynamic frequency converters; smoke detectors; equipment and apparatus such as controllers for detecting and rectifying transmission errorselectronic controllers; television transmitterstelecommunications transmitters; transmitters of electronic signals; optical transmitters; antennas; radio frequency antennas; satellite antennasreceiving antennas for satellite broadcast; magnetic encoders; data encoding equipment and apparatus; encryption and decryption equipment and apparatus; decoders for television sets; broadband modulators; demodulators; speech recognition equipment and apparatus being computers; authenticationidentification and access control equipment and apparatusdownloadable computer software for use in computer access control; routers for computer networks routers; electronic time recording equipment and apparatustime trackertime recorder; distance recording apparatuslaser distance meters; sound recording mediablank sound recording strips and sound recording carriers; optical fibers; loudspeakers; cabinets for loudspeakers; fire alarms; electricity indicators of electricity; data processing equipment and apparatus; Intercommunication equipment and apparatustelecommunication gatewaymodemsroutersdata concentrators for energy measurement; computer interfaces; power switches; inverters of electricity; downloadable software for monitoring and transmitting remote or embedded remote sensor status; downloadable game software; downloadable software for sendingstoring or processing computer data online; lasers not for medical use; computer readersusb card readers; cassette players; compact disk players; optical readers; optical lenses; optical sensors; connections for electric lines; current transformers and rectifierselectrical transformers; video recorders; tool measuring instruments; microphones; microprocessors; video monitors; navigation apparatus and equipment for vehicles (GPS); optical switches; computersmini-computersmicro-computersterminals thereof and peripherals thereof; computer memory devices; computer peripheral devices; downloadable computer operating programs; Photographic equipment and apparatuscameras; data processorscomputer central processing units; computer central processing units; recorded operating system programs; radio equipment and apparatusradio receivers; television receiversreceivers for television signals via satelliteterrestrialcableinternetmobile networks; electric relays; telephone answering machines; sound reproduction apparatussound reproductionrecordingtransmission equipment and apparatus; Apparatus and equipment for communication of informationwritingimagesspeech and datatelephone transmitters; telephone apparatus for concentrating voicedata and images; equipment and apparatus for the reproductionrecording or transmission of imagesvideo and sound; intercommunication apparatuscomputer peripherals; Terminals for secured control connection to the Internetparental control home apparatus such as internet terminals; electric surveillance equipment and apparatusvideo cameras; step-up transformers; electronic apparatuselectronic display boards; inertial navigation systems consisting of a computermotion sensorstemperature sensorsmagnetometer sensorshumidity sensorspressure sensors and gyroscopes; testing and maintenance apparatus for inertial equipmentinertial remote control panels; electric control panels; remote control equipment and apparatus for radiostelevisionsstereos-excluding gaming apparatusvideo camerascomputers; remote measuring equipment and apparatusconnected sensors for measuring electric consumptionwater consumptionheat consumptiongas consumptionthermal energy; steering equipment and apparatuswireless home networkwireless gateways; telephone concentrator apparatus and equipmenttelephone connected to a network concentratora hub or switch for processing of voicedata and images; television apparatus for projection purposes; television transmitters; downloadable computer programs for remote processing of data; computer terminals; mini-computing terminalshardware device that can be used for entering data intotranscribing data from micro-computing terminalsset top boxesvideo soundboxbox delivering high quality still and moving picturessound and voice assistant; remote surveillance electrical terminals unitterminals for surveillance of health dataelectric consumptionwater consumptionheat consumptiongas consumptionthermal energy; calculation terminals for electric consumptionwater consumptionheat consumptiongas consumptionthermal energy; Computer terminal for conversion of mobile data for processingtransportingtransmittingreceivingamplifying and restoring datastill and moving imagessoundvideo telephonyvideo transmissions and teleprinting; computer terminal for control of video communicationteledistributionteleconferencingremote managementtelemeteringremote alarm; radio devicesradio receivers for use in radio communications; terminalscomputer peripheral devicesremote controls; electric sensors; water and gas sensors for scientific use to gather water and gas data; microphone modules; Mobile radio modules for telephone communication; modems; mpeg video codecs in the nature of encoders; recording devicesmulti-track recorders; digital cartography software to collect healthwater energygas energy secured data; vehicle navigation and positioning equipment and apparatusGPS navigation device; satellite and radio-electric positionning apparatus for transmitting data and signals; sirens for vehiclessignalling and automatic control equipment and apparatus for vehicles; navigational apparatus for vehiclesin the nature of on-board computers; radars detectors; radio beacons machines and apparatus; radar machines and apparatus; digital television decoders; digital decoders for operatorstelecommunication operatorsservices operators; receivers for terrestrial digital television; reception terminals for terrestrial digital television; radio frequency power meters; downloadable software for updating equipment such as internet or energy gatewayset-top boxesmeter for measuring healthwater energygas energy secured data; apparatus for video surveillance apparatuscomputer hardware for IP video surveillanceelectric and electronic video surveillance installations; incident detection apparatusmotion detectors
Class 38
Transmission of information by computer servers; services for sending transmission of information via free access data communication; transmission and exchanges of data on multimedia carriersinstant messaging serviceselectronic mail; electronic sending of messagestelematic sending of informationdatasound and images by radio relaycableoptical fiberstelephonesatelliteterminalstelecommunication networks and computer networks; electronic transmission of data included in technical databases; information transmission for others via a worldwide computer network hotline; on-line information transmission concerning collected data; electronic transmission via the Internet of online consultations in the field of mobile and wireless telephonycomputer access networksfibre optical networksradio communications networksdigital televisioncomputer modules and modemscomputers
Class 42
Engineering; services of engineers in the field of engineering design services in the domain of electronic devices and networkssoftware engineering services; computer system design; consultancy services relating to computer software; conversion of data or documents from physical to electronic media; design and development of software for importing and managing data; software development design; technical project studiesengineering studies in the nature of technical project planning for new products; technical project studies relating to electrical and electronic equipment and systems and telecommunications; technical project studies for the construction of telecommunications relay stationsfor the production of telecommunications hardwarefor data transmission and software installations; rental of computer software; computer rental; technical project study for electronic devices and computer software and maintenance of computer software; updating of computer software; programming for computers for others; research and development of new products for others; secured electronic transmission of data collected on an intranet and the Internet; document digitization services; document digitization services for digitizing physical documents into a digital electronic medium