Class 3
Non-medicated toiletries; soapsshower and bath gel; cosmetics; essential oils; hair care preparationsshampoo; aftershavebalms and creamsperfumeeau de cologne and toilet water; preparations for the cleansing of the skinbodyhands and feet; deodorants and anti-perspirants for use on the person; talcum powder; dentifricescold creams
Class 5
Filled first aid boxes and kits; medicated antibiotic cold creams for the treatment of sporting injuries; antiseptic preparations; analgesics; vitaminmineral supplements; protein preparationssoy protein for use for use as a nutritional ingredient in various powdered and ready to drink beverages; mineral supplement drinks; vitamin fortified drinks; drinks enriched with minerals or vitamins; vitamin and dietary supplements; food supplements; plant compounds and extracts for use as dietary supplements; bandages for dressings; disinfectants for hygiene purposes; foods for medically restricted diets for sports persons
Class 9
Telecommunication installationsapparatus and instrumentstelephone apparatus; telephonesmobile telephonescordless telephones; telephone answering apparatus paging apparatus; apparatus for recordingtransmission or reproduction of sound or images; exposed camera film; video cameras; camera lenses; camcorders; television sets; television receivers for receiving satellite broadcasting; satellites and television decoders; video tape recorders; video disc players; combined television set and video tape recorder (VCR); remote control for televisions; audio systemsstereosspeakers and amplifiers; electrical audio playback machines; radio receivers; CD players; personal CD players; tape recorders; tape players; record players; graphic equalizers; headphones; audio speakersloudspeakersearphone speakersspeaker cables; amplifiers; radiosradios incorporating clocks; karaoke machinesjuke boxes; computerslap-top and notebook computersgame computersvideo output game machines for use with televisions; computer peripherals; computer terminals; computer hardwarecomputer software for organizing and viewing digital images and photographs in the field of sportsleisure and fitness; computer programs for pre-recorded games in the field of sportleisure and fitness; disc drives; CD ROM drives; computer games programs; video game software; video output games adapted for use with television receivers; electronic gamesvideo gameshand held remote controls for playing electronic games; cabinets and stands all adapted for audiovideo and television equipment; calculating machines; hologram apparatus; magnifying glasses; pedometers; periscopes; batteriesbattery chargersbattery boxes; electric plugs; electric irons; electric hair curling irons; electric hair waving apparatus; electrically heated hair curlers; binoculars; eyewearsportsspectaclessunglassessports goggles for use in playing squash; swimming goggles; frames and lenses for spectacles and sunglasses; cases for spectacles and sunglasses; chains and cords for spectacles and sunglasses; protective helmets; sports helmets with visors; protective clothingheadgear and footwear for use in sport; face shields; life beltsjackets and buoys; clothing for protection against accidentsradiation and fire; ear plugs for swimming; filters for respiratory masks; computer carrying casesbags designed for carrying vinyl recordsreplacement parts for all the aforesaid goods
Class 11
Apparatus for cookinggas cookers and electric slow cookers; barbecuesgas and electric; stovesgas and electric; replacement parts for all the aforesaid goods
Class 12
Motorized golf carts; golf trolleys; motorized land vehicles for golf use; tyre inflating machines; tyre protection chains; air pumps for bicycles; baskets adapted for cycles; bells for bicyclesbicycles; bicycle partsbicycle brakes; chains; frames; handle bars; tyres for bicycles and motorcycles; rims; saddles and spokes for wheels; bicycle bells; gears for bicycles; pedals for bicycles; saddle covers for bicycles; wheels for bicycles; ball bearings for automotive use; bicycle stands; panniers adapted for cycles; fittings for bicycles for carrying beverages; luggage carriers and nets for cycles; and replacement parts for all the aforesaid goods
Class 14
Clocks incorporating radios; Clocks and watches; sports watcheshorological and chronomatic instruments; watch straps; tankards of precious metal; trophiesbelt bucklesall being of precious metal or coated therewith; jewelry and imitation jewelry; time keeping instrumentsalarm clocks; ashtrays of precious metal; badges of precious metal; boxes of precious metal; boxes of precious metal for needles; bracelets; medalscandle rings of precious metal; candlesticks of precious metal; cases for clock and watch-making; cases for watches; chainsjewelry of precious metal; clock cases; clock hands; coffee pots non electric and household containers all of precious metal; imitation gold; jewel cases of precious metal; key rings of precious metal; kitchen containers of precious metal; kitchen utensils of precious metal; rings being jewelry; saucers of precious metal; cufflinkstie clipstie pins; watch bands; wrist watches; ornaments of precious metals; trinkets made of precious metals or coated therewith; replacement parts for all the aforesaid goods
Class 16
Books in the field of sport and leisurepicturespostersprintsgraphic art reproductionswriting implementspostcardsstationery; glues for stationery; bindersgreeting cardsball pensfelt pens; nib pensmechanical pencils; photographsalbums for photographstoilet tissuestoilet paperrolls of paperpaper towelsall for use in the kitchen; address booksbinder note booksloose leaf padsnote bookswire bound note booksword note booksbook endspaint brushescalendarsdiariesphotograph standsprinted instructional and teaching materials in the field of sport and leisure; sign penspen standspencil standsphoto stands; stickers; printed periodicals in the field of sport and leisuremagazines for sport and leisurenewspapers; iron on transfers and decalcomaniaspen trayspencil trayspaper handkerchiefswriting paper; catalogues in the field of sport and leisurebrochures and leaflets in the field of sport and leisure; wrapping and packing materialspaper; cheque book holders; replacement parts for all the aforesaid goods
Class 18
Animal skins and hides; luggagetrunkstraveling bagstraveling casescarry-on luggageovernight luggagebags for travel accessoriesshoe bags for travel and garment bags for travel ; briefcasesdocument cases and portfolios; school bags and school satchelsholdalls for clothinghaversacksbackpacksrucksacksknapsackshandbagsshoulder bagsclutch bagstote bagssports bagsathletic bagsbeach bagspannier bagsbelt bagstoilet bags sold empty; waist pouches; saddle belts ; walletspursesframes for handbagsumbrellas or parasols; straps of leather; business card cases ; umbrellasgolf umbrellasgolf umbrella seatsparasolscanes and walking sticks; whipsharnesses and saddlery ; replacement parts for the aforesaid goods
Class 24
Textile wall hangings; linen and upholstery fabrics; bed linenbed coversbed clothesbed spreadsquilt coversduvet coversbed sheetspillow casespillow coversquiltsduvetseiderdownsbath linentowelsflannelsface towelsshower curtains; table linentable coverstable cloths not of paper; kitchen towelstea towels; curtainscurtain tie backscushion covershandkerchiefs; upholstery fabrics
Class 25
Footwear; sports shoestraining shoesbootswalking bootssoccer bootsshoescycling shoes ; headwear; waterproof and weatherproof clothingjackets and pants; thermal clothingunderwear and socks; lightweight clothingvests; coats; sports clothingT-shirtstrack suitsvestsfleecepullovers; jacketsanorakspulloverstrousersshirtsT-shirtscagouleswaterproof jackets and coatssmock and salopettes ; gloveshatsbalaclavassocksunderwear and gaiters ; visors; belts; footwear for use in sports
Class 28
Gymnastic apparatus; sporting equipment for use in boxingboxing bagsboxing glovesboxing swivelspunching balls for boxing practice; sporting equipment for use in gymnasticsbalance beamsexercise and gymnastic bannersgymnastic horizontal barsgymnastic parallel barsgymnastic vaulting horsespommel horsesspringboards for gymnastics; and sporting equipment for use in playing the gamesbadminton setssquash rackets and ballsfield hockey sticksballs and padsice hockey stickspuckspads and glovesfootballslacrosse balls and stickstable tennis paddlesballs and netsnetball balls and netsballs for games and sport ballslawn tennis rackets and ballscricket balls and batscroquet setsclock golf setsgolf clubs for use in the game of clock golfquoitsflying discs and putting golf balls and water polo balls ; balls for use in sports; balloons; Christmas tree decorations; sports bags especially adapted for sports equipment; electronic gameshand-held unit for playing electronic games; modeled miniature plastic toy figurinesartificial Christmas trees and Christmas tree stands; kaleidoscopes; protective clothing for use in sportfootball knee pads and soccer shin pads; abdominal guards for athletic use; mouth guards for athletic use; floats for bathing and swimming; wheeled carriers for golfing usenon-motorized golf carts
Class 30
Popcorn; husked oats; oat flakes; oat based food; muesli; corn flakes; corn flour; corn meal; maize flakes; maize flour; maize meal; gluten for food; potato flour for food; soya flour; biscuits; malt biscuits; petit-beurre biscuits; cookies; edible decorations for cakes; cakes; tarts; petit fours; macaroons; breadleaven ginger breadbread rollsbunspastrypastrieswafflespancakespizzaspastillespastaravioliribbon vermicellinoodle vermicellispaghettimacaroni; chocolate; cocoacocoa based beveragescoffee beverages with milkconfectionerychocolatescandiespastriescakes; fondants; confectionery for decorating Christmas treespowdered sugarcrystallized sugarcandy canespeppermint flavored candies; stick liquoriceliquoricenon- medicated lozengescandy caramelscandy for foodmaltosegum sweetspralinespeppermint sweetssugarnatural sweetenersspicesallspicecurrygingercinnamonclovesseasoningssaltcooking saltcelery saltsalt for preserving foodstuffspepperseasoning peppersmustardaniseedsaffronvanilla substitutevanillinalmond pastestarch for foodice creamedible icesice sherbetsice sorbetsice for refreshmentglucose for foodhoneyricesagotapioca for foodturmeric for foodyeastpiesmeat piesgroats for human foodpuddingssandwichessaucesketchupnon-medicinal herbal infusionsvinegarbeer vinegarsalad dressingsmayonnaise; instant powder for making tea
Class 32
Soft drinks; beers; mineral and aerated waters and other non-alcoholic drinksflavoured water; fruit drinks and fruit juices; syrups and other preparations for making fruit flavoured beverages; shandyde-alcoholized drinksbeernon-alcoholic beers and wines; syrups for beverages; sorbet beverages; non-alcoholic fruit extracts used in the preparation of beverages; concentrate preparations in the form of powder for making into fruit drinks; spring water other than for medical purposes; instant powder for making soft drinksfruit drinksfruit juicessports drinks and flavored water