Classe 5
Pharmaceutical goods for supplementing foodmade from or for use with the following goods: carbohydratesproteinscaffeinevitaminsminerals; food supplements consisting of proteinalso being enriched with carbohydratescaffeinevitaminsmineralsfor medical purposes in liquidcompressedpowdergel and sugar coated formbeing components for foodstuffs and nonalcoholic beverages; food supplements consisting of carbohydrates being enriched with caffeinevitaminsmineralsfor medical purposes in liquidcompressedpowdergel and sugar coated formbeing components for foodstuffs and non-alcoholic beverages; nutritional supplements for medical purposes; food supplementsnot for medical purposes; dietetic foodstuffs adapted for medical use; nutritional supplements on the basis of protein; dietetic foodstuffs for medical usebased on protein from hen eggsanimal muscles meatanimal connective tissuesmilk and wheywheatsoyapeaslupinsfava beanslentilschick peassunflowerspumpkinhemp seedfalse flaxcommon duckweedalgaenuts or insects; food supplement preparationsthe aforesaid goods made of proteinscarbohydratesvitaminsmineralscaffeinenot for medical purposes; nutritional supplements consisting of the following goods: carbohydratesvitaminsproteinsmineralstrace elements; food supplements made from or using dextrose not for medical purposes; dietary supplements in the form of effervescent tablets; meal replacement powders adapted for medical use; food supplements consisting of liquid carbohydrate gels for athletes; food supplements consisting of liquid protein gels or athletes; food supplements consisting of liquid gels containing proteins to aid muscle developmentmuscle maintenancehigh protein nutrition; all of the above for human consumption
Classe 30
Coffee; tea; sugar; bakery goods; confectionery goodshard-boiled candiesfruit gumfruit gums with vitaminsfruit gums with caffeinefruit gums with mineralsfruit gums with vitamins and minerals and caffeinefizzy glucose drops or tablets; pizzas; cakes; chocolate; cocoa; bread; spreads based on cocoa; preparations for making bakery goodspowder for making bakery goodsnamely as waferspancakes; pizza dough; cereal bars containing proteinsmixed with nutscocoachocolatehoneyraisinsmineralsvitaminscaffeine; carbohydrate bars being grain-based food barsmixed with proteinsnutscocoachocolatehoneyraisinsmineralsvitaminscaffeine; high protein cereal barsmixed with nutscocoachocolatehoneyraisinsmineralsvitaminscaffeine; muesliincluding mixed with proteinsnutscocoachocolatehoneyraisinsmineralsvitaminscaffeine; porridge; chips being cereal products mixed with proteinsnutscocoachocolatehoneyraisinsmineralsvitaminscaffeine; confectionery made of sugar; sweets; candy; chewing gumnot for medical purposes; processed cereal mixes containing proteins; fruit sauces; pancakes; edible ices; edible ices based on protein; protein containing cereal balls being protein balls; baking powder consisting of protein concentrate; snacks and crunchy snack barsnot included in other classesmuesli barsenergy barsprotein bars; food mainly consisting of dextroseenriched with and containing vitaminsmineralscaffeinefor use as foodstuffs or as ingredients for foodstuffs or non-alcoholic beverageschewing gumsenergy gumsenergy fruit gumsdextrose or glucose tablets; foodstuffsnamely long- life bakery goods in the form of cereal bars containing carbohydratesmixed with nutscocoachocolatefruitshoneyraisinsmilk proteintapioca starchmineralsvitaminscaffeine; carbohydrate bars being grain-based food bars; high-protein cereal bars; flavourings for foods other than essential oils; dextrose preparations for fooddextrose powder; dextrose for food in liquidcompressedpowdersugar-coated formbeing ingredients for foodstuffs and/or non-alcoholic beverages; nutrient concentrates mainly consisting of dextrosebeing enriched with vitaminsmineralscaffeinenot for medical purposesin liquidcompressedpowdergel and sugar coated formbeing ingredients for food and non-alcoholic beverages; tea-based beverages; all the aforesaid goods included in this class also being dietetic substances not adapted for medical use; all of the above for human consumption
Classe 32
Non-alcoholic beverages containing proteinssport drinksenergy drinkswater beverages; non-alcoholic beverages containing amino acidssport drinksenergy drinkswater beverages; smoothies; whey beverages; flavoured whey beverages; whey beverages containing fruit juices; non-alcoholic beveragessport drinksenergy drinkswater beverages; nonalcoholic beverages enriched with vitaminssport drinksenergy drinkswater beverages; non-alcoholic beverages based on fruit juices; non-alcoholic beverages based on water; non-alcoholic fruit beverages; non-alcoholic flavoured beveragessport drinksenergy drinkswater beverages; non-alcoholic beverages containing dextrosesport drinksenergy drinkswater beverages; fruit based beverages; vegetable juices; powders and preparations for making non-alcoholic beveragesfor making sports and energy drinks; preparations made of carbohydratesfruit extractsvitaminsmineralscaffeinewheyprotein for making non-alcoholic beveragesfor making sports and energy drinks; powders containing minerals carbohydratesfruit extractsvitaminsmineralscaffeinewheyprotein for making nonalcoholic beveragesfor making sports and energy drinks; instantly soluble effervescent tablets containing dextrose for beveragesfor making sports and energy drinks; effervescent tablets containing protein for beveragesfor making sports and energy drinks; all the aforesaid goods included in this class also being dietetic substances not adapted for medical use; all of the above for human consumption