(11) 98705-3426
TrademarkIQ íconeTrademarkIQ
Voltar para busca
Dado oficial do USPTO

LIVE YOUR BEST

Sabia que essa marca já está registrada no Estados Unidos?

Antes de investir em nome, identidade e divulgação, valide risco de colisão e estratégia de registro para não perder tempo nem budget.

Active USPTO registrationTipo: VerbalEscritório: US

Snapshot rápido

LIVE YOUR BEST

ST13

US500000079369747

Classe

1, 7, 8, 9, 11, 17, 35, 37, 42

Pedido

79369747

Registro

7854054

Diagnóstico de risco e oportunidade

Leitura executiva para decisão de naming, protocolo e monitoramento.

Atenção: há risco ativo

Situação USPTO

Active USPTO registration

Tipo de processo

Pedido e registro

Eventos registrados

68

Atualização mais recente

08/08/2026

Classificação

Registrada

Tipo de marca

Verbal

Classes Nice

1, 7, 8, 9, 11, 17, 35, 37, 42

Data de depósito

15/09/2022

Data de registro

08/07/2025

Data de expiração

-

Ação recomendada

Execute uma análise de colidência completa e valide classes antes de qualquer protocolo ou investimento de marca.

Próximo passo

Esses são os detalhes do processo de registro. Mesmo assim, o monitoramento constante é o que garante tranquilidade de que o seu principal ativo continue protegido.

Dados completos do processo

Campos estruturados da autoridade responsável e do histórico oficial.

Data da situação

08/07/2025

Última transação

08/08/2026

Escritório responsável

United States Patent and Trademark Office

Código da situação

700

Cadastro oficial

Principal Register

Código do desenho

4

Tipo de titular

03

Localização do titular

JP

Examinador

MANOR, THOMAS M

Localização atual

Historical data usage

Titulares e representantes

Titulares

Panasonic Holdings Corporation

Representantes

Sandra Epp Ryan HSML P.C.

Classificação técnica

Classes Nice

Classe 1Classe 7Classe 8Classe 9Classe 11Classe 17Classe 35Classe 37Classe 42

Códigos Vienna

Sem códigos Vienna disponíveis.

Produtos e serviços

Classe 1

Chemicals preparations for use in industry; glue and adhesives for industrial purposes; plant growth regulating preparations; horticultural chemicalsexcept fungicidesherbicidesinsecticides and parasiticides; agricultural chemicalsexcept fungicidesherbicidesinsecticides and parasiticides; fertilizers; ceramic glazing in the nature of a dry chemical preparation for use in the manufacture of ceramics; oil cement putty; fatty acids for industrial purposes; alkaline metals; olivine (silicate mineral)filtering materials of mineral substances; mineral substances used to oxidize impurities and regulate temperatures in glass production furnaces; spinel (oxide mineral); non-metallic minerals for use in manufacture; non-metallic mineral sorbents; non-metallic mineral fertilizing preparations; chemical compositions for developing and printing photographs; reagent paper not for medical purposes; artificial sweeteners for industrial and food industry purposes; flour and starch for industrial purposes; plasticsunprocessed; plastics in unprocessed formin powderliquid or paste form; groundwood pulp or chemical pulps for manufacturing purposes; soldering preparations; conductive adhesives for industrial purposes; zinc oxide for use in manufacture; liquid coating preparations in the nature of chemical coatings for printed circuits; chemical coatings used in the manufacture of printed circuit boards; soldering fluxes; adhesives for industrial purposes; adhesives for use in the manufacture of electronic devices; chemical agents for water purification; graphites for industrial purposes; biological preparationsother than for medical or veterinary purposes; fuel for nuclear reactors; by-products of the processing of cereals for industrial purposes; detergents for use in manufacturing processes; milk ferments for chemical purposes; cultures of microorganismsother than for medical and veterinary use; ceramic compositions for sintering in granule and powder form; cellulose; cellulose esters for industrial purposes; cellulose ethers for industrial purposes; acetate of celluloseunprocessed; cellulose plasticsunprocessed; cellulose-plastic composite materialsunprocessed; cellulose-fibre reinforced plasticsunprocessed; cellulose acetate plasticsunprocessed; cellulose pulp

Classe 7

Power-operated hand-held toolsdrillsscrewdriverspower-operated hand-held crimpers; motorsother than for land vehicles; machine coupling and transmission components except for land vehicles; agricultural implementsother than hand operated hand toolshay balerscoultersseed drills; incubators for eggs; vending machines; electric welding machines; industrial robots; soldering apparatusgas-operated; soldering apparatuselectric; machines for mounting IC chips on circuit boards; semiconductor manufacturing apparatus and machines; electric arc welding apparatus; cutting machines; metal cutting machines; metalworking machines; metalworking machine tools; electronic component placement machines for use in the manufacturing processes of electric and electronic appliances; automatic machines for inserting electronic components into printed circuit boards; electronic component feeding machines and apparatus for manufacturing electronic circuit boards; diebonding machines for manufacturing semiconductors; flip chip bonding machines for manufacturing semiconductors; flat panel display assembly machines; electronic circuit assembly machines; laser processing machines and apparatus for metalworkingglassworkingplastic processing or semiconductor manufacturing; engraving machines; condensing installations being air condensers; condensing installations being axial fan condensers; condensing installations being air-cooled condensers; condensing installations being condensers of air; condensing installations being steam condensers; condensing installations being condensing boilers being parts of machines; electric power-operated hand tools in the nature of power-operated hand held crimpers; chucks for power drills; grinding machines for metalworking; power-operated saws; motor driven saws; blades for power saws; heat exchangers being parts of engines; extracting machines for chemical processing; chemical processing machines and apparatus; dispensing machines for packaging or wrapping medicines; industrial printing machines; 3D printers; motorselectricother than for land vehicles; starters for motors and engines; current generators; wind-powered installations for generating electricitywind farms; AC generators being alternators; centrifugal blowersnot for specified purposes; axial flow blowersnot for specified purposes; reduction gears machine elements not for land vehicles; lifting machinespower-operated lifting machines for moving drilling rigs; loading-unloading machines and apparatusloading machines; elevators; electric door openers; curtain drawing deviceselectrically operated; electric washing machines for industrial purposes; electric washing machines for household purposes; washing machines for laundry; dishwashers; compressors for machines; pumps for machines; hydraulic pumps; electric pumps; mixing machines; die-cutting machines; food cuttingchopping and slicing machines; food mixing machines; food processorselectric; electric hand mixers for household purposes; electric food processors for household purposes; electric coffee mills being coffee grinders; electric food blenders for household purposes; kitchen machineselectric standing mixers; electric kitchen machines for making whipped cream; kitchen machinesdough kneader; electric kitchen machinessalad spinners; electric juicers for household purposes; electric meat grinders for household purposes; rice polishing machines; food and beverage processing machines and apparatus; electric ice crushers; garbage disposal units; vacuum cleaners; electric machines and apparatus for wax-polishing for industrial purposes; electric machines and apparatus for wax-polishing for household purposes; floor polishing machines and apparatuselectric; power operating blowers not for specified purposes; air suction machines; vacuum cleaner bags; electric dust collecting machines; apparatus for aerating water; wrapping machines; filters for motors and engines; gas filters for engines; agricultural machinescultivatorsharvestersdisk harrowsseeders; composting machines; automatic transportation machines for supplying chemical materials in production lines; exhaust gas treatment apparatus for motors of semiconductor manufacturing apparatus; exhaust gas treatment apparatus for motors and engines; urethane foaming machines; painting machines and apparatus; waste disposal units; waste compacting machines and apparatus for industrial purposes; waste crushing machines for industrial purposes; pulp makingpapermaking and paper-working machines and apparatus; printing and bookbinding machines and apparatus; sewing machines; agricultural machines and agricultural implementsother than hand operatedmotor hoesharvesters; packaging and wrapping machines and apparatus; plastic processing machines and apparatus; stone working machines and apparatus; boilers for non-electric prime movers and engines; feed water heaters for nonelectric prime movers and engines; parts of boilers for non-electric prime movers and engines parts of feed water; heaters for nonelectric prime movers and engines; vehicle washing installations; couplings for machines; cams being parts of machines; bearing housings for machines; fluid couplings being parts of machines; transmissions for machines; torque convertersnot for land vehicles; shock absorbers for machines; springs being parts of machines; brakes for machines; chemical processing machines for waste solvent recovery and recycling; mining machines and apparatus; industrial fishing machines; filtering machines for chemical processing; cartridges for filtering machines; electric hand-held drills; electric hand-held mixers for household purposes; hand-held grinders being power tools; escalators; textile making-up machines; textile tentering machines; textile scutching machines; knitting machines; spinning machines; machines for the mineralisation of drinking water; electric brewing machines for industrial use; beverage preparation machineselectromechanical; food preparation machineselectromechanical; woodworking machines; glue gunselectric; papermaking machines; leather-working machines; leather tanning machines; shoe making machines; glassworking machines; sealing machines for industrial purposes; labellers being machineselectronic label printing machines for commercial use; labellers being machinesautomatic industrial labeling machines for applying labels to containers and bottles; machines and apparatus for manufacturing rubber goods; adhesive tape dispensers being machines; fuel dispensing machines for service stations; mechanical parking systems; lawnmowers; window openerselectric; window closerselectric; door openerselectric; door closerselectric; drilling heads being parts of machines; robotic exoskeleton suitsother than for medical purposes; food processing machines and apparatuselectric food peeling machines; Injection moulding machines; extrusion moulding machines; compression moulding machines; plastic jet moulding machines; tables being accessories for machines; apparatus for machining; finishing machines; machines and apparatus for polishingelectric; high pressure washers; steam cleaning machines; acetylene cleaning apparatus; cleaning machines for ponds; cleaning machines for aviation engines; suction cleaning machines (vacuum cleaners); window cleaning equipmentelectric; filters being parts of machines or engines; coffee grindersother than hand-operated; bicycle assembling machines; dust removing installations for cleaning purposes; steam mops; cleaning and laundry robots with artificial intelligence for household use; parts and fittings for all the aforesaid goods

Classe 8

Hand tools and implementshand-operateddrillsscrewdrivershammers; table cutlery; side armsnot including firearmsswordshunting knives; razors; electric shavers; electric razors; razor blades; table cutleryknivesforks and spoons; blades for electric shavers; blades for electric clippers for hair and nail; blades for electric hair trimmers; electric hair clippers; hair clippers for animals being hand instruments; electric beard trimmers; depilation applianceselectric and non-electric; nail polisherselectric and non-electric; manicure setselectric and non-electric; pedicure setselectric and non-electric; tool belts; mustache and beard trimmers; electric hair trimmers; electric ear hair trimmers; electric nasal hair trimmers; electric hair straightening irons; curling tongs; electric irons for styling hair; electric hair curling irons; eyelash curlers; hand implements for hair curling; electric flat irons; blades for electric razors; nail fileselectric; shaving cases; razor cases; insecticide atomizers being hand tools; air pumpshand-operated; Hand-operated sprayers for insecticides; hand-operated pumps for aquariums; hand operated kitchen mandolines for cutting foods; vegetable shreddershand-operated; vegetable slicershand-operated; can openersnon-electric; non-electric hair straightening irons; flat ironsnon-electric; curling ironsnon-electric; garden toolshand-operatedtrowelsweeding forksspadeshoes; parts and fittings for all the aforesaid goods

Classe 9

Scientific researchnavigationsurveyingphotographiccinematographicaudiovisualopticalweighingmeasuringdetectingtestinginspecting and teaching apparatus and instrumentselectron microscopessatellite-aided navigation systemscamera filtersaudiovisual receivers; apparatus and instruments for conductingswitchingtransformingaccumulatingregulating or controlling the distribution or use of electricityelectricity conduitselectricity distribution consoleselectricity meters; computer network hubsswitches and routers; digital video recorders; blank optical discs; blank optical data carriers; digital audio players and recorders; recorded and downloadable mediaaudio filesvideo recordings and multimedia files featuring games and sports; blank digital storage media; blank analogue recording storage media; blank electronic storage media; recorded analogue recording storage mediaaudio filesvideo recordings and multimedia files featuring games and sports; recorded storage mediaaudio filesvideo recordings and multimedia files featuring games and sports; mechanisms for coin-operated apparatus; cash registerscalculating machinesdata processing equipmentcomputers; recorded and downloadable computer software for use in managing supply and demand chains in the retailgrocerywholesale distributionmanufacturingtraveltransportationhospitality and media industries; recorded and downloadable computer software for use in editingorganizing mininganalyzing and reporting business data used for managing and planning business operationsallocating business resourcestracking inventoryconducting customer resource managementevaluating pricing and revenue; recorded and downloadable computer software used for managing production schedulesplanning and scheduling transportation shipments and overseeing and managing warehouse and shipping logistics; recorded and downloadable computer software used for managingmininganalyzing and reporting business dataverifying pricesordering inventoryoperating retail stores and warehouses; recorded and downloadable computer software used to access and transmit retailer and supplier product data via a global computer network; recorded and downloadable computer software for predictive analyticsbusiness data analysisbig dataprocessing and analyzing large volumes of data; recorded and downloadable computer software for electronic security and surveillance of residential and commercial buildings; recorded and downloadable computer software for programmingcontrolling and operating programmable controllers used in production lines; recorded and downloadable computer software for processing digital images and graphics; recorded and downloadable computer operating software for use with medical and beauty care apparatus; recorded and downloadable computer software for use in the transmission of data and information; recorded and downloadable computer software for use in customer relationship management; recorded and downloadable computer software to monitor and control factory manufacturing processes; recorded and downloadable database management software for visible light communication; recorded and downloadable database management software for location information; recorded and downloadable computer software for retail inventory management; recorded and downloadable computer software for enterprise data management; recorded and downloadable computer software for video teleconferencing; recorded and downloadable computer software for processing images and graphics; recorded and downloadable computer software for management of enterprise data; recorded and downloadable computer software for use in the management of multipoint video surveillance systems; recorded and downloadable computer software for OCR (optical character recognition); recorded and downloadable computer software for use with medical and beauty care apparatus; recorded and downloadable computer software for database management software for visible light communication; recorded and downloadable computer software for database management software for location information; recorded and downloadable computer software for image recognition; recorded and downloadable computer software for image retrieval; recorded and downloadable computer software for image management; recorded and downloadable computer software that enables users to requestshareuploadviewdiscoveranalyze data and information obtained from electronic devices; recorded and downloadable computer software for database managementdata analysisdocument managementdocument analysisvideo managementanalysis; recorded and downloadable computer softwarea search engine for videoimagedocuments and other digital data; recorded and downloadable computer software to enable connection to databasescomputer networks and the Internet; recorded and downloadable computer software for use in the field of VLC (visible light communications) for the transmission of electronic datavideomusicimagetext and sound; recorded and downloadable computer software in the fields of cooking and household appliance use and operation; recorded and downloadable software using artificial intelligence (AI) for home automation; recorded and downloadable software for home automation of electric control systems for electrical power switches; recorded and downloadable software for home automation of electric control systems for home security systems; recorded and downloadable software for home automation of electric control systems for HVAC; recorded and downloadable software for home automation of electric control systems for kitchen appliances; recorded and downloadable software for home automation of electric control systems for lighting; recorded and downloadable computer software for controlling household appliances; recorded and downloadable computer software for use in controlling heatmoisture levelstiming of cooking processes and parametersincluding communicating various cooking instructions between computerscomputer networksperipheral communications devices; recorded and downloadable computer software for use in connection with cooking instruction; recorded and downloadable computer software for mobile phoneseducational software featuring instruction in the field of cateringcookeryfood and drink; recorded and downloadable computer software for simulation of interior space design and planning; recorded and downloadable computer software for simulation of lighting planning; recorded and downloadable computer software for operation and control of water treatment systems; recorded and downloadable computer software for monitoring air contaminants and pollutants; recorded and downloadable computer software for visualization and analysis of air flow; recorded and downloadable computer software for managing electrical use and lighting use; recorded and downloadable computer operating program; recorded and downloadable computer softwaresoftware development kits (SDKs) consisting of computer software for the developmentuseinteroperability of APIs that are used by electronic devicessystems; recorded and downloadable computer software for use in processingstoring and accessing information of faces in order to verify and identify the persons in the field of personal authentication; recorded and downloadable computer software for use in face recognition; fire extinguishers; cameras; cinematographic machines and apparatus; camera cases; digital still cameras; digital photo frames; electrical batteries and cells; dry cells; rechargeable batteries; electric accumulators; accumulators being batteries; accumulator boxes; electric batteries for vehicles; electric batteries for electric vehicles; batteries for mobile phones; battery chargers; nickel-cadmium batteries; nickel-metal hydride batteries; lithium batteries; lithium ion batteries; fuel cells; solar batteries; converterselectric; solar panels for electricity generation; battery chargers for electric vehicles; electric wiring devices and instruments in the nature of socketsreceptaclesswitchescontrollers; electric wires and cables; sensor switcheselectric; electronic motion sensitive switches; electrical connectors; switcheselectric; electric sockets; light switches; time switches; electro-magnetic switches; light dimmers; plugboards; electric switch boxes; electrical cabling; electricity conduits; electricity ducts; electric cable racks; lighting ballasts; circuit breakers; electric circuit protectors; thermal overload relays; power distributing boxes; electrical outlets; power strips; current converters; covers for electric outlets; antennas aerials; voltage monitoring units; control panels for electricity; electronic indicator panels; electricity terminal blocks; indicator lights for circuit boards; signalling lamps being safety lights; modular jacks for telephones; electrical adapters; power adapters; earth terminals; electrical extension cords; modular jacks for networks being electrical outlets; modular jacks for networksEthernet adapters; electrical ducts; gas leak alarms; fire alarms; electronic door alarms; security alarms; electronic baby security alarms; baby movement alarms; personal security alarms; anti-intrusion security alarms; smoke alarms; burglar alarms; window security alarms; vibrating security alarms; vibrating alarm to take medication incorporated into plastic medication cases sold empty as a reminder to take medication; video intercoms; intercoms; electronic glass break detectors; passive infrared detectors; infrared detectors; electric door chimes; radio transmitters and receivers; electric buzzers; fire detection systems comprised of smoke detectorsheat detectorsalarms and notification devicesfire alarm control panels; emergency alarms for detection of fires; emergency alarmsgas alarms; electric warning lights; electric emergency signaling lights being luminous signals; emergency warning lights; electric locks; electronic video surveillance systems comprised of electronic components of security systems; video surveillance systems in the nature of electric and electronic video surveillance installations; access control devicesaccess control and alarm monitoring systems; face recognition equipment for access controlsvideo cameras with integrated recorded computer programs using artificial intelligence for use in facial recognition; iris recognition access control systemsiris recognition security devices; cameras for iris recognition security; surveillance cameras; illuminated exit signs; apparatus and instruments for remote monitoring in the nature of a remote video monitoring system consisting primarily of a camera and video monitor for recording and transmitting images to a remote location; apparatus and instruments for remote communicationearpieces and headsets for remote communication; remote control apparatus for radiostelevisionsstereos; radios; digital audio tape players and recorders; digital video players and recorders; portable media players; MP3 players; cases for portable media players; audio speakers; stereo tuners; amplifiers; power amplifiers; microphones for telecommunication apparatus; record players; record player turntables; digital voice recorders; digital sound processors; electric and electronic effects units for musical instruments; metronomes; electronic circuits and CD-ROMs recorded with automatic performance programs for electronic musical instruments; electric and electronic phasers being effects units for electric or electronic musical instruments; headphones; earphones; stereos; stereo components; audio mixers; audio cassette head cleaning apparatus being tapes; audio head cleaning apparatushead cleaning tapes for audio recorders; optical fiber cables; audio and video cables; wireless microphone systems comprising microphonestransmitters and receiversspeakersamplifiers and tuners; audio equalizers; electronic audio signal processors; car audio apparatus being car stereos; car audio apparatusaudio speakers for automobilesradios for vehiclescar stereos; rearview cameras for vehicles; rearview monitors for vehicles; woofers; subwoofers; automatic compact disc changers; automatic disc changers in the nature of compact disc players; Audio frequency amplifiers; television receivers being TV sets; plasma televisions; plasma display panel televisions; electronic apparatusplasma display panels; stands for televisions; mounting brackets adapted for televisions; liquid crystal display (LCD) televisions; LCDs being liquid crystal displays; liquid crystal display panels; wireless liquid crystal display (LCD) monitors; organic light emitting diodes (OLED) displays; organic light-emitting diode (OLED) televisions; organic light-emitting diodes (OLED); 3D televisions; audio and video player-combined televisions; video tuners; video projectors; digital video projectors; liquid crystal display (LCD) projectors; lenses for videodigital videomovieoverhead and LCD projectors; videotape recorders; video tape players; video cameras being camcorders; tripods for cameras; DVD recorders; DVD players; cable television receivers; set-top boxes; computer hardware and downloadable software for displaying educational materials; electronic display boards; video cameras for broadcasting; computer hardware and downloadable software for use in DVD authoring; light emitting diode displays; in-vehicle cameras; network monitoring cameras; video surveillance cameras; electronic switchers for audio and video signals for live streaming and broadcasting; downloadable electronic publications in the nature of magazinesbooksbrochures and instruction manuals in the field of environmentally focused investments; exposed cinematographic films; exposed slide films; slide film mounts; video monitors; electronic video switchers; video switchers being video mixing desks; electronic video mixers; video mixers in the nature of video mixing desks; home theater systemscomprising digital video playersaudio amplifiers and audio speakers; electronic video signal splitters; video signal splitters for electronic apparatus; optical character recognition apparatus; optical readers; 3D spectacles; spectacleseyeglasses and goggles for safetysportsswimmingprotection against dust; virtual reality headsets; satellite receivers; optical disc drives; optical disc recorders; optical disc players; telecommunication machines and apparatuswireless transmitters and receivers; facsimile apparatus; telephone sets; portable telephones; smartphones; smartwatches; accessories for mobile phonesbattery packscaseslanyardschargersholderspower supply adaptersheadsetsearphones and microphones; cell phone cases; cell phone straps; cell phone battery chargers; earphones for cellular telephones; hands-free kits for cellular telephones; cordless telephones; telephone answering apparatus; private branch exchanges; Global Positioning System (GPS) apparatus; walkie-talkies; encoding and decoding apparatus; navigation apparatus for vehicles being on-board computers; navigational apparatus for automobiles; digital signage; remote controllers for radiostelevisionsstereoslighting installationsair conditionerscamerascamcorders; electrical power distribution units; electric power distribution machines; electric power controllers; programmable logic controllers; computers; computer peripheral devices; tablet computers; mobile computers; wearable computers in the nature of smartwatches and smartglasses; hard disc drives; USB cables; image scanners; document printers for use with computers; toner cartridgesunfilledfor printers and photocopiers; photo printers; video printers; digital colour copiers; photo-copying machines; photocopiersphotographicelectrostaticthermic; multi-functional electronic devices for printing documents; electronic blackboards; electronic whiteboards; PC computer memory cards; computer keyboards; floppy disc drives; electronic card readers; electronic card readers and writers; bar code readers; bar code scanners; electronic mobile data terminalsnamely computer terminals; electronic cash registers; automated teller machines (ATM); network routers; monitors being computer hardware; computer port replicatorscomputer docking stations; downloadable electronic maps; downloadable image and video files featuring video gamesanimals and art works; downloadable music files; phonograph records featuring music; downloadable digital image files authenticated by non-fungible tokens (NFTs) in the field of avatarseyewearfootwearclothingart workstoyspetsfurniture and home electric appliances; downloadable image files in the field of music and movies; downloadable image files featuring avatars for metaverse environments; downloadable image files featuring tradeable virtual goods for metaverse environmentsavatarseyewearfootwearclothingart workstoyspetsfurniture and home electric appliances; recorded video discs and video tapes featuring musicgamemoviesanimation; prerecorded DVDs featuring music and movies; blank DVDs; pre-recorded interactive DVDs for children featuring movies and television programs about fictional and real characters; pre-recorded DVDs for a corporate wellness program featuring work injury prevention information; recorded and downloadable computer programs for use in managing supply and demand chains in the retailgrocerywholesale distributionmanufacturingtraveltransportationhospitality and media industries; recorded and downloadable computer programs for use in editingorganizing mininganalyzing and reporting business data used for managing and planning business operationsallocating business resourcestracking inventoryconducting customer resource managementevaluating pricing and revenue; recorded and downloadable computer programs used for managing production schedulesplanning and scheduling transportation shipments and overseeing and managing warehouse and shipping logistics; recorded and downloadable computer programs used for managingmininganalyzing and reporting business dataverifying pricesordering inventoryoperating retail stores and warehouses; recorded and downloadable computer programs used to access and transmit retailer and supplier product data via a global computer network; recorded and downloadable computer programs for predictive analyticsbusiness data analysisbig dataprocessing and analyzing large volumes of data; recorded and downloadable computer programs for electronic security and surveillance of residential and commercial buildings; recorded and downloadable computer programs for programmingcontrolling and operating programmable controllers used in production lines; recorded and downloadable computer programs for processing digital images and graphics; recorded and downloadable computer operating programs for use with medical and beauty care apparatus; recorded and downloadable computer programs for use in the transmission of data and information; recorded and downloadable computer programs for use in customer relationship management; recorded and downloadable computer programs to monitor and control factory manufacturing processes; recorded and downloadable database management programs for visible light communication; recorded and downloadable database management programs for location information; recorded and downloadable computer programs for retail inventory management; recorded and downloadable computer programs for enterprise data management; recorded and downloadable computer programs for video teleconferencing; recorded and downloadable computer programs for processing images and graphics; recorded and downloadable computer programs for management of enterprise data; recorded and downloadable computer programs for use in the management of multipoint video surveillance systems; recorded and downloadable computer programs for OCR (optical character recognition); Downloadable computer operating and managing software for use with medical and beauty care apparatus; recorded and downloadable computer programs for database management software for visible light communication; recorded and downloadable computer programs for database management software for location information; recorded and downloadable computer programs for image recognition; recorded and downloadable computer programs for image retrieval; recorded and downloadable computer programs for image management; recorded and downloadable computer programs that enables users to requestshareuploadviewdiscoveranalyze data and information obtained from electronic devices; recorded and downloadable computer programs for database managementdata analysisdocument managementdocument analysisvideo managementanalysis; recorded and downloadable computer programs namelya search engine for videoimagedocuments and other digital data; recorded and downloadable computer programs to enable connection to databasescomputer networks and the Internet; recorded and downloadable computer programs for use in the field of VLC (visible light communications) for the transmission of electronic datavideomusicimagetext and sound; recorded and downloadable computer programs in the fields of cooking and household appliance use and operation; recorded and downloadable computer programs using artificial intelligence (AI) for home automation; recorded and downloadable computer programs for home automation of electric control systems for electrical power switches; recorded and downloadable computer programs for home automation of electric control systems for home security systems; recorded and downloadable computer programs for home automation of electric control systems for HVAC; recorded and downloadable computer programs for home automation of electric control systems for kitchen appliances; recorded and downloadable computer programs for home automation of electric control systems for lighting; recorded and downloadable computer programs for controlling household appliances; recorded and downloadable computer programs for use in controlling heatmoisture levelstiming of cooking processes and parametersincluding communicating various cooking instructions between computerscomputer networksperipheral communications devices; recorded and downloadable computer programs for use in connection with cooking instruction; recorded and downloadable computer programs for mobile phoneseducational software featuring instruction in the field of cateringcookeryfood and drink; recorded and downloadable computer programs for simulation of interior space design and planning; recorded and downloadable computer programs for simulation of lighting planning; recorded and downloadable computer programs for operation and control of water treatment systems; recorded and downloadable computer programs for monitoring air contaminants and pollutants; recorded and downloadable computer programs for visualization and analysis of air flow; recorded and downloadable computer programs for managing electrical use and lighting use; Downloadable and recorded software development kits (SDKs) consisting of computer software for the developmentuseinteroperability of APIs that are used by electronic devicessystems; recorded and downloadable computer programs for use in processingstoring and accessing information of faces in order to verify and identify the persons in the field of personal authentication; recorded and downloadable computer programs for use in face recognition; recorded and downloadable computer program for remotely monitoring environment and condition and controlling devices within a buildingfacility and designated separate area; recorded and downloadable computer program for remotely controlling lighting devices within a buildingfacilities and designated separate area; recorded and downloadable computer program for the purpose of remotely monitoring and controlling electric appliance; recorded and downloadable computer program for displaying advertisement; recorded and downloadable computer programs for allowing users to remotely interact withmonitorcontrol the operation of electric appliances; recorded and downloadable computer program for use to connect and control internet of things (Iot) electronic devices; recorded and downloadable computer programs and software for image processing used for mobile phones; recorded and downloadable computer programs for accessing and using the internet; recorded and downloadable computer programs for enabling access or entrance control; recorded and downloadable computer program for the processing and analysis of pattern recognition data using artificial intelligence and natural language processing; recorded and downloadable computer program for use as an application programming interface (API); recorded and downloadable computer program for providing personal concierge services for others via a mobile phonecomputertabletsmart phonehandheld computerportable computeradding and accessing calendar appointmentsalarmstimersreminders and making restauranttravelhotel reservations; recorded and downloadable computer program for personal information management; recorded and downloadable computer program for providing consumer assistant for searchinglocating and providing directions for the purchaseconsumption and use of a wide range of consumer productsservices and information over a global communications network; recorded and downloadable computer programs for remote monitoring of the functioning and use of air conditioning apparatuswater heaterslighting apparatus and freezing machines and apparatus; scientific research and laboratory apparatusbioreactors for cell culturing for scientific researchdroppers for laboratory usedrying ovens for laboratory use; computer hardware for image recognition for security and surveillance purposes; recorded and downloadable software for image recognition for security and surveillance purposes; computer hardware for video surveillance of factory production lines; recorded and downloadable software for video surveillance of factory production lines; radio-frequency modulators; computer networks comprised of hubsswitchesinterface deviceshardwarerouters; computer servers; data storage mediablank tapes for storage of computer data; blank videotapes; head cleaning tapes for audio and video tape recorders and players; blank audio tapes; blank floppy computer disks; pre-recorded optical discs featuring music and movie; memory cards; IC memory cards; semiconductor apparatus and devices being memory unitswaferschip sets; dosimeters; countersparticle counterspill counter and geiger counters; ammeters; temperature indicators; voltmeters; bathroom scales; pedometers; calorie consumption monitors for use during sporting activities; wearable computers in the nature of smartwatches incorporating exercise intensity and pitch monitors for use during sporting activities; gasometers; water meters; wattmeters; distance measuring apparatus; alarmaccelerationelectric sensors; light-emitting diodes (LED); micro-computer; semi-conductors; semi-conductor memories; semiconductor integrated circuits; oxygen regulators; radio signal tuners; radio frequency modulators; coin validatorscoin acceptors for separating good coins from counterfeits; currency recognition machines; counterfeit coin detectors; coin sorting machines; apparatus for checking the authenticity of banknotes; electrical power supplies; electricity inductors; electric capacitors; power capacitors; diodes; transistors; electric signal filters; electromagnetic noise reduction filters; optical modulators; optical transmitters; optical sensors; optical connectors; optical lenses; electric circuits; electric transformers; thermistors; varistors; oscillators; acousto-optic modulators; electric resistors; potentiometers; thermal cutoffs; encoders; magneto-resistive sensors; electromagnetic coils; choke coils for electric apparatus; current sensors; touch panels; duplexers; surface acoustic wave sensors; surface acoustic wave filters; baluns; wireless communication devices for voicedata or image transmission; radio frequency amplifiers; frequency synthesizers; laser diodes; magnetic cores; resistance wires; electrodesother than welding electrodes or medical electrodes; fuses for electric current; relayselectric; solenoid valves being electromagnetic switches; electric inverters; electric timer switches; electrical circuit boards; printed circuit boards; circuit overload protector devices; ionization apparatus for scientific or laboratory use; ionization apparatus for eliminating static electricity; magnetron oscillators; internal cooling fans for electronic devices; internal cooling fans for communication devices; lasersnot for medical purposes; marking gauges for joinery; road signsluminous or mechanical; vehicle breakdown warning triangles; uninterruptible electrical power supplies; time clocks being time recording devices; electric adapters for power line communication; measuring machines and instrumentslevel measuring machines for surveying; surface roughness testing machines and instruments; moisture meters; microscopes; safety helmets; riding helmets; protective helmets for sports; sports whistles; humanoid robots with artificial intelligence for entertainment purposes for use in scientific researchaerospace research and aerospace exploration; humanoid robots with artificial intelligence for use in having communication and learning functions for assisting and entertaining people; laboratory robots; temperature controllers for heating units for industrial purposes; electrical terminal blocks; raster image processors; semiconductor inspection apparatus; incubators for bacteria culture; constant temperature and humidity incubators for laboratory use; plant growth chambers for laboratory use in the nature of incubators; clean benches for laboratory uselaboratory countertops; biological safety cabinets for laboratory use; computer hardware for VLC (visible light communications) for the transmission of electronic datavideomusicimagetext and sound; downloadable and recorded software for VLC (visible light communications) for the transmission of electronic datavideomusicimagetext and sound; computer hardware for Internet of Things (IoT) sold as a unitrouterssurveillance cameras and wireless communication devices for voicedata or image transmission; recorded and downloadable software for Internet of Things (IoT) for controlmanagement and operation of routerssurveillance camera and wireless communication devices for voicedata or image transmission sold as a unit; computer hardware to enable machine-to-machine (M2M) communication; downloadable and recorded software to enable machine-to-machine (M2M) communication; computer hardware for text-to-speech converting; downloadable and recorded software for text-to-speech converting; computer hardware for management of customer information sold as a unit; recorded and downloadable software for management of customer information sold as a unit; computer hardware for point-of-sales (POS) systems comprised primarily of point-of-sale terminalsbar code readerstouchscreen monitorskeyboardsdocument printersscannersrecorded operating software sold as a unit; recorded and downloadable software for point-of-sales (POS) systems comprised primarily of point-of-sale terminalsbar code readerstouchscreen monitorskeyboardsdocument printersscannersrecorded operating software sold as a unit; computer database servers; recorded and downloadable computer groupware for use in database managementuse as a spread sheetword processing; recorded and downloadable cloud computing software for deploying virtual machines to a cloud computing platformmanaging virtual machines on a cloud computing platform; electronic control units for vehicles; electronic control units for vehicle batteries; head-up displays for vehicles; sonars; digital panel meters; electronic data archiving apparatus for use in the storage and management of computer datasolid state drives; electronic data storing apparatus in the nature of memory cards; clothing for protection against accidentsirradiation and fire; fireproof garments; hoods for protection against accidents or injury from disaster; dust masks; gas masks; welding masks; protective masks for prevention of accident or injury; Work fall prevention and work positioning equipment for industrial and construction useone or more wheeled anchorstethers and connectors that help raiselowerpositionmaintain a person or object on a roof or similar environment and prevents a person or object from falling from a roof or similar environment; protection devices against X-raysnot for medical purposesgloves for protection against X-rays for industrial purposes and x-ray shields for protection against X-rays for industrial purposes; hearing protection devicesearbudsear plugs for diversprotective ear covering shields and ear hooks for eyeglasses; eye and face protection devicessafety goggles; head protection devicesprotective helmets and diving helmets; respiratory protection devicesprotective industrial respiratory marks; hand protection devicesprotective work gloves and protective gloves for industrial use; teeth protectors for safety purposesbeing mouth guards; gloves for protection against accidentsirradiation and fire; shoes for protection against accidentsirradiation and fire; protective helmets; shoes for protection against accidentsirradiation and fire in industry; gloves for protection against accidentsirradiation and fire for work and industry; gloves for protection against accidents for work and industry; simulators for the steering and control of vehicles; electronic sports training simulators; satellites for scientific purposes; slide-rules; neon signs; electronic ticket dispensers; photovoltaic apparatus and installations for generating solar electricity; electric discharge tubesother than for lighting; security surveillance robots; anti-theft warning apparatustheft alarms; Downloadable and recorded game programs for arcade video game machines; apparatus for fermentation for laboratory apparatus; apparatus for testing food; apparatus for testing smoke detectors using an aerosol spray; semiconductor testing apparatus; testing apparatus for testing printed circuit boards; apparatus for testing vehicle brakes; apparatus for testing breast milkother than for medical or veterinary use; electronic testing apparatus for use in the field of telecommunications; electronic apparatus for testing the sterility of pharmaceuticals and injectable solutions; electronic apparatus for testing the sterility of medical equipment; apparatus for testing vehicle transmissions; probes for scientific purposes; power line conditioners; personal digital assistants; pantographs being electric current collectors; teaching robots; Diagnostic apparatus for testing food; diagnostic apparatus for research laboratory use for detection of pathogensnot for medical purposesfor testing the performance of vehicleshome appliancesaudio instrumentsfor DNA analysis; hand-held diagnostic scanners for testing vehicles; diagnostic apparatus for testing the performance of home appliances; diagnostic apparatus for testing the performance of audio instruments; teaching apparatus in the nature of hairdressing training heads; teaching apparatus in the nature of artificial limbs for medical instruction purposes; teaching apparatus in the nature of resuscitation mannequins; teaching apparatus namelyelectronic book readersaudio books in the nature of short stories; parts and fittings for all the aforesaid goods

Classe 11

Heating installations; air heating apparatus; floor heating apparatus; air cooling apparatus; space cooling apparatus; beverage cooling apparatus; water cooling installations; apparatus for steam generating; steam generating installations; apparatus for cookingcooktops harvest drying apparatus; drying apparatus for chemical processing; air-conditioningair cooling and ventilation apparatus and instruments; filters for use with apparatus for water supply apparatus for the separation of gases for sanitary purposes; sanitary installations in the nature of steam rooms; lighting apparatuslighting installations; lighting apparatus and installationslighting installations and lighting fixtures; electric light bulbs; standing paper lanterns (andon); portable paper lanterns (chochin); gas lamps; oil lamps; lamp chimneys; electric lamps; incandescent lamps; miniature light bulbs; pocket search lights; electric lanterns; motion sensitive security lights; discharge lamps; stage lighting apparatus; wall lights; ceiling lights; germicidal lamps; chandeliers; downlights; desk lights; sockets for electric lights; spotlights; safety lamps; light diffusers; searchlights; bicycle lights; electric fans; portable searchlights; penlights; household electrothermic appliances being toastersmicrowave ovenselectric cooking ovenselectric rangeselectric kettleselectric coffee makershair dryersportable heaters used to heat a small areaportable electric heatersclothes Ironselectric rice cookerselectric slow cookerselectric blankets not for medical purposeselectric grillselectric skilletswater heaters; installations for cookingcooking ranges; electric cooking utensilselectric slow cookerselectric cooking potselectric bread cookers; cooking apparatus and installations for commercial useelectric ranges for commercial useconvection ovenscombination ovenselectric grills for commercial usegas grills for commercial useelectric griddleselectric deep fryerselectric and gas broilerselectric and gas roasterssteam generatorstilt skilletselectric braising panspizza ovenspasta cookerscharbroilersexhaust hoods for kitchenswalk-In coolersfreezerselectric food warmers and holding cabinetsbeverage dispensers; kitchen sinks incorporating integrated worktops; microwave ovens; bread baking machines; kettleselectric; electric cooking pots; electric pressure cookers; electrical rice cookers; electric rice warmers; electric food warmers; electric roasters; cooking ovens; electric toasters; electric sandwich toasters; electric coffee makers; electric ice cream makers; electric cooking stoves; gas cookers; induction cookers; electric cookers namelyelectric cooking ovenselectrical rice cookerselectric range cookerselectric cooktopsbuilt-in electric ovensfreestanding electric cookersslow cookerselectric pressure cookers; electric cooking pans; electric fermenting machines for food products for household purposes; kitchen sinks; tap water faucets; washers for water taps; electric frying pans; refrigerators; gas refrigerators; freezers; water dispensers; heating and cooling apparatus for dispensing hot and cold beverages; water coolers; ice makers; cool boxes in the nature of coolerselectric; refrigerating display cabinets; refrigerating showcases; freezing showcases; heat exchanger-typed air cooling units for domestic use and commercial use; ventilating apparatus and instrumentsexhaust fans; ventilating fans for household purposes; dehumidifiers; humidifiers; air curtains in the nature of air doors; ceiling fans; ventilating fans; electrostatic precipitators for cleaning air; electric air blowers for air conditioning or ventilating; air purifying apparatus and machines; filters for air purifiers; range hoods being extractor hoodsfor household purposes; filters for air conditioning; installations for air heating; warming pans for beds; non-electric pocket warmerschemically-activated heating packets for warming hands not for medical purposes; hot water bottles for warming one's feet in bed; stoves being space heaters for household purposesnon-electric; air-conditioning apparatus; air conditioners for vehicles; air filters for air conditioners; heat exchangersnot parts of machinesfor air conditioning; electrically heated carpets; electric space heaters; electric blanketsnot for medical purposes; electric radiant heaters; hot-water space heating apparatus; electric heating apparatus; electric foot warmers; heaters for vehicles; electric water heaters; water heaters; gas fired heaters; gas water heaters; heat pumps; solar water heaters; wastewater treatment apparatus; waste water treatment tanks for industrial purposes; septic tanks for industrial purposes; water supply installationmetered valves; watering installationsautomaticirrigation sprinklers; toilet stool units with a washing water squirter; disinfectant apparatus for dispensing solutions into water-pipes for sanitary installations; hand disinfectant apparatus with automatic spraying disinfectant solutions; hand disinfectant apparatus with automatic spraying disinfectant solutions of stand type for commercial use; sauna apparatus; showers; shower heads; heating boilersother than parts of machines; bathtub enclosures; bathtubs; bath fittings being bath cubicles; bath fittings being shower cubicles; bath fittings being shower doors; bath fittings being shower trays; showerheads; faucets; plumbing fittingsdrains and sink strainers; bath fittings being water control valves for bathroom faucets; bath fittings being sinks; bath installations; prefabricated bath installations sold as a unit; bath tub jets; whirlpool baths; toilets; toilet bowls; water ionizers; bidets; toiletsportable; portable bidets; wash-hand basins being parts of sanitary installations; sterilizers; water softening apparatus; water purifying apparatus and machines; touchless hand drying apparatus; clothes dryers; electric clothes drying machines; hand dryers; hair driers for household purposes; electric dish dryers; dish drying machines; electric hair steamers for beauty salon use; electric hair steamers for household use; steam facial apparatus being saunas; steam facial apparatus in the nature of saunas; towel steamers for hairdressing purposes; hair drying machines for beauty salon use; hair steamers for beauty salon use; shampoo basins for barbers' shop use; electric facial sauna apparatus for cleaning pores; electric autoclaves for cooking; fabric steamers; watering machines for agricultural purposes; electric dispensers for air fresheners; ventilation hoods; air deodorising apparatus; apparatus for generating ultrapure water; cooling water circulation apparatus; hazardous liquid treatment apparatus; air nozzles for air conditioning; thermal incineration installations; waste liquid solvent treatment installations; incinerators; garbage incinerators; automatic temperature regulators for central heating radiators; fan coil units for air conditioning; ionization apparatus for the treatment of air or water; ozone water generators; refrigerating containers; freezing containers; coffee roasters; ovensother than for laboratory use; sterilizers for dental instruments; sterilizers for air conditioning; sterilizers for household purposes; sterilizers for medical instruments; toilet seats; electric steam facial apparatus for household purposes; parts and fittings for all the aforesaid goods

Classe 17

Semi-processed plastics; plastics and resins in the form of sheetsrodsfoilsblockstubes and films; latex rubber; sealing materials; semiconductor sealing materials; insulating materials; electrical insulating materials; thermal insulating materials; glass wool for insulation; thermal setting resinssemi-processed; thermoplastic resinssemi-processed; metal foil-laminated plastic sheets; resin-impregnated carbon fibre materials; carbon fibre-reinforced plasticssemi-processednot for textile use; condenser paper; laminated plastic boards; copper-clad laminated plastic boards; insulating materials for printed circuit boards; copper foil-laminated plastic sheets; vacuum insulation materials; fibre-reinforced plasticssemi-processed; valves of india-rubber or vulcanized fibre; pipe gaskets; junctions for pipesnot of metal; joint packings for pipes; floating anti-pollution barriers; washers of rubber or vulcanized fiber; rings of rubber; carbon fibresother than for textile use; plastic fibresother than for textile use; chemical fibernot for textile use; rock wool; * mineral wool * slag wool for use as a building insulator; rubber thread and covered rubber yarnnot for textile use; chemical fiber yarn and threadnot for textile use; insulating gloves; cords of rubber; industrial packaging containers of rubber; rubber stoppers; rubber lids and caps for industrial packaging containers; plastic sheeting for agricultural purposes; paper for electrical capacitors; vulcanized fiber; adhesive tapesother than stationery and not for medical or household purposes; plastic semi-worked synthetic plastic and synthetic resins as semi-finished products in the form of pelletsrodsfoilsfoamsfibersfilms and sheets; rubberraw or semi-worked; soundproofing materials of mineral woolnot for building purposes; substances for insulating buildings against moisture; caulking materials; non-conducting materials for retaining heat; chemical compositions for repairing leaks in pipes; fibreglass for insulation; insulating fabrics; insulating refractory materials; soundproofing materials; packing being cushioning and stuffing materials of rubber or plastics; plastic films for electromagnetic shielding; graphite sheets being thermally conductive insulators; adhesive tapes of cellulose-fibre reinforced plasticsother than stationery and not for medical or household purposes; cellulose-plastic composite materials for use in manufacture; cellulose-fibre reinforced plasticssemi-processed; cellulose-fibre reinforced plastics in the form of filmsrodsfoilssheetsblockstubes and bars; cellulose acetatesemi-processed; cellulose fibresnot for textile use; cellulose acetate filmother than for wrapping; plastic filmother than for wrapping

Classe 35

Advertising; business managementorganization and administration; office functions; providing information concerning commercial sales; business information services; commercial information agency services; rental of photocopying machines; publicity material rental; rental of vending machines; office machines and equipment rental; advertising and publicity services; providing employment information; arranging newspaper subscriptions for others; data processing services being office functions; commercial information and advice for consumers in the choice of products and services; arranging subscriptions to telecommunication services for others; business information and consulting services relating to the electric energy industry; business management analysis and business consultancy; marketing research and analysis; drawing up of financial statements; business administrative services for the relocation of personnel; business planning services and consultancy relating thereto; inventory management services and consultancy relating thereto; sales management services and consultancy relating thereto; business project management services and consultancy relating thereto; client and customer relationship management services and consultancy relating thereto; business management and administration of the purchase and sale of goods and consultancy relating thereto; telephone answering services and consultancy relating thereto; providing multilingual business information and consultancy relating thereto; computerized business operations management services and consultancy relating thereto; assistance and consultancy in the field of business management and monitoring of companies in the energy sector; customer information database management services and consultancy relating thereto; computerized data management services; development of advertising conceptsproduction and distribution of advertising materials; billing services in electronic commerce transactions; business consulting services in the fields of energy consumption and usage conservation to improve energy efficiency; personnel management services and consultancy thereto; collectingproviding and analysis of customer information for commercial or advertising purposes; business information analysis; business research and analysis of behavior patterns of customersemployees and users; business research and analysis of moving patterns of objectscargos and materials; organization or management of exhibitions for commercial and advertising purposes; business consultancy services in the field of agriculture; employment agency services; import-export agencies; compilation of information into computer databases; providing business assistance to others in the operation of data processing apparatuscomputerstypewritersmachines that transmit and receive messages converted into signals which are transmittedeither by electricity or by radio signalsthen printed out by a machine in another place and other similar office machinesoffice labeling machinesscannersplotters; reception services for visitors in buildings being office functions in the nature of greeting visitors in offices; providing commercial information and advice for consumers in the choice of products and services; providing information about newspaper articles being news clipping services; personnel recruitment; document reproduction in the nature of photocopying services; office functionsfiling of documents and magnetic tapes; appointment reminder services being office functions; computerized file management; office functions in the nature of searching for data in computer files for others; registration of written communications and data in the field of state vehicular registrationsownership of stocks and bonds not including domain names; news clipping services; business administration of consumer loyalty programs; promotion of goods and services through sponsorship of sports events; marketing servicesanalysisresearchassessment; Providing television home shopping services in the field of general consumer merchandise sales promotion for others; sales promotion for others; business management consulting services in the field of environmental impactconservationpreservation and protectionproviding information and consultancy relating thereto; providing information and consultancy relating to all the aforesaid services

Classe 37

Construction servicesbuilding constructionexcavationgrading; earthworks services in the nature of excavating for building construction and construction of civil engineering structures using concrete; building construction supervision services for building projects; building construction services; construction project management services; services for construction site preparationexcavation services for construction sites; construction servicesconcrete pavingsite clearingexcavationpad preparationgrading and asphalt paving services and building renovation; services for building demolition; construction consultancy; maintenance of building equipmentelevators and boilers; operation and maintenance of building equipmentwater pipes and sanitary installations; installationrepair or maintenance of consumer electric appliances; installationrepair or maintenance of radios; installationrepair or maintenance of television sets; installationrepair or maintenance of telecommunication apparatus and machines; installationrepair or maintenance of household electric appliances; installationrepair or maintenance of lighting apparatus; installationrepair or maintenance of power distribution and control machines and apparatus; installationrepair or maintenance of electric motors; installationrepair or maintenance of measuring apparatus and instruments; installationrepair or maintenance of testing apparatus and instruments; installationrepair or maintenance of medical apparatus and instruments; installationrepair or maintenance of metalworking machines and tools; installationrepair or maintenance of cooking apparatus; installationrepair or maintenance of automatic vending machines; installationrepair or maintenance of water purifying apparatus; installationrepair or maintenance of musical instruments; installationrepair or maintenance of watches and clocks; installationrepair or maintenance of water heaters; installationrepair or maintenance of bath equipmentsauna apparatusshowersshower headswater heatersboilersbathtub enclosuresbathtubsbath cubiclesshower cubiclesbath installations; installationrepair or maintenance of toilet stool units with a washing water squirter; installationrepair or maintenance of computer hardware; installationrepair or maintenance of air-conditioning apparatus; installationrepair or maintenance of office machines and equipment; installation of machines; repair of vehicles; maintenance of vehicles; installationrepair and maintenance of computers and computer peripherals; installationrepair or maintenance of computer printers; installationrepair or maintenance of printing machines; installationrepair or maintenance of 3D printers; installationrepair or maintenance of telephones; telecommunication wiring; rental of construction equipment; installationrepair or maintenance of laboratory apparatus and instruments; installation and maintenance of electronic apparatus; repair of electronic apparatus; installationrepair or maintenance of wheelchairs; Providing construction information; installationrepair or maintenance of freezing machines and apparatus; rental of laundry washing machines; rental of cleaning machines; rental of laundry dryers; installationrepair and maintenance of CD playersDVD playersdigital audio playersaudio recorderssound reproducing apparatusvideo recorders and video reproducing apparatus; installation of audio-visual equipment; installation of industrial machinery; installation of manufacturing machines and apparatus; installationrepair or maintenance of welding machines and apparatus; installation of radio apparatus and instruments; installation of radio systems and networks; consultancy relating to the repair or maintenance of measuring and testing machines and instruments; providing information relating to the repair or maintenance of measuring and testing machines and instruments; lift installation and repair; installation or adjustment of antennas; maintenance and repair of buildings; building construction supervision; installationrepair or maintenance of transport and storage containers; installationrepair or maintenance of lockers; providing information relating to the repair or maintenance of cinematographic machines and apparatus; providing information relating to the repair or maintenance of optical machines and instruments; providing information relating to the repair or maintenance of photographic machines and apparatus; providing information relating to the repair or maintenance of fire alarms; providing information relating to laundering services; providing information relating to cleaning of clothing or household fabric linen products; providing information relating to cleaning of kitchens or kitchen countertops; providing information relating to cleaning of bath fittings or installations; providing information relating to cleaning of water purification installations; providing information relating to sterilization of medical instruments; services of electricians; disinfecting of building interior surfaces for reducing the spread of viruses and microorganisms; vehicle battery charging; charging of electric vehicles; upholstery repair; repair of power lines; rental of spin dryers for clothes; rental of dish drying machines; rental of dish washing machines; providing information and consultancy relating to all the aforesaid services

Classe 42

Scientific research; technological research in the field of manufacturing processescomputer hardware systemsrenewable energy resources and energy and power needs of others; industrial analysis services in the field of waste water treatmentfood and beverages; industrial research in the field of manufacturing processescomputer hardware systems and renewable energy resources; industrial design services; design and development of computer hardware and software; computer software design; computer programming; maintenance of computer software; computer system design; configuration of computer systems; testing and research services relating to electric and electronic machinesapparatus and instruments; computer rental; providing temporary use of non-downloadable computer programs on online data computer networks in the field of image recognitionretrieval and management; providing temporary use of online non-downloadable software for remotely monitoring environment and condition and controlling devices within a buildingfacility and designated separate area; providing temporary use of online non-downloadable software for remotely controlling lighting devices within a buildingfacilities and designated separate area; providing temporary use of online non-downloadable software for the purpose of remotely monitoring and controlling electric appliance; providing temporary use of online non-downloadable software for displaying advertisement; providing temporary use of online non-downloadable software for proposing adequate operation candidate of electric appliance; providing temporary use of online non-downloadable software for use to connect and control internet of things (Iot) electronic devices; providing temporary use of online non-downloadable software for image processing used for mobile phones; providing temporary use of online non-downloadable software for accessing and using the internet; providing temporary use of online non-downloadable software for enabling access or entrance control; providing temporary use of online non-downloadable software for the processing and analysis of pattern recognition data using artificial intelligence and natural language processing; providing temporary use of online non-downloadable software for providing personal concierge services for others via a mobile phonecomputertabletsmart phonehandheld computerportable computeradding and accessing calendar appointmentsalarmstimersreminders and making restauranttravelhotel reservations; providing temporary use of online non-downloadable software for personal information management; providing temporary use of online non-downloadable software for providing consumer assistant for searchinglocating and providing directions for the purchaseconsumption and use of a wide range of consumer productsservices and information over a global communications network; providing temporary use of online non-downloadable software for use in supply chain management; website design; hosting computer sites being web sites; updating of computer software; recovery of computer data; hosting websites for others; maintaining websites for others; Application service providerproviding temporary use of non-downloadable computer software development kits (SDKs) consisting of computer software for the developmentuseinteroperability of APIs that are used by electronic devicessystems; Application service providerproviding temporary use of non-downloadable computer software featuring application programming interface (API) software with the function of integration of video content into websitesmonitoringautomating and scheduling of smart devices and access to a cloud service solutionhome and environmental monitoringcontrolautomation; file sharing serviceshosting and maintenance of a website featuring technology enabling users to upload and download electronic files; photo sharing serviceshosting and maintenance of a website featuring technology enabling users to uploadviewdownload digital photos; providing online and web-based non-downloadable computer software for use in digital image processing; providing online and web-based non-downloadable computer software for browsing information on the Internet; electronic data storage; rental of electronic storage space on servers the Internet; rental of web servers; providing meteorological information; technological advice relating to computersautomobiles and industrial machines; testing and research services in the field of electricity; architectural design; construction design services; cartography services; hosting and maintenance of a website featuring technology enabling users to upload and download electronic files; hosting and maintenance of a website featuring technology enabling users to edit photoscreate photo albums and upload photos and photo albums; hosting and maintenance of a website featuring technology that enables online electronic conference systems via cloud computing; computer software diagnostic services; providing computer systems for remote desktop solutions being remote access to computers through cloud computing; computer system monitoringmaintenance of software related thereto for ensuring proper functioning; computer system designinstallation of software related thereto; computer software technical support servicestroubleshooting of computer software and hardware problems; providing technological information relating to computer equipment inspection; providing technical advice in the field of scientific and industrial research in the field of manufacturing processescomputer hardware systems and renewable energy resources; technological advice relating to assessment of information security vulnerability; technological information relating to data and information analysis in the field of programmable controllers used in production lines; technological information relating to data and information analysis in the field of processing images and graphics; technological information relating to data and information analysis in the field of medical and beauty care apparatus; technological information relating to data and information analysis in the field of the transmission of data and information; technological information relating to data and information analysis in the field of customer relationship management; technological information relating to data and information analysis in the field of monitor and control of factory manufacturing processes; technological information relating to data and information analysis in the field of visible light communication; technological information relating to data and information analysis in the field of location information; technological information relating to data and information analysis in the field of energy management and monitoring; technological information relating to data and information analysis in the field of ensuring security of internet access; technological information relating to data and information analysis in the field of image recognitionsound recognitionvoice recognitioninternet securitytransmission of datadata miningdata querydata analysis and visualizing data; technological information relating to data and information analysis in the field of image recognitionretrieval and management; technological information relating to data and information analysis in the field of uploadbrowseviewclassificationmanagement and share of digital videoimage or documents; technological information relating to data and information analysis in the field of database managementdata analysisdocument managementdocument analysisvideo managementanalysis; technological information relating to data and information analysis in the field of information security and for the encryptiondecryption and authentication of datafor digital certificate issuanceverificationmanagementfor the verification and management of digital keys and credentials; technological information relating to data and information analysis in the field of videoimagedocument and other data via the cloud database to view digital evidence and upload evidencelog eventsbookmark and classify incidents captured in the foregoing files; technological information relating to data and information analysis in the field of electronic devices; technological information relating to data and information analysis in the field of environment and condition and controlling devices within a buildingfacility and designated separate area; technological information relating to data and information analysis in the field of lighting devices within a buildingfacilities and designated separate area; technological information relating to data and information analysis in the field of electric appliance; technological information relating to data and information analysis in the field of displaying advertisement; technological information relating to data and information analysis in the field of image processing used for mobile phones; technological information relating to data and information analysis in the field of the internet; technological information relating to data and information analysis in the field of access or entrance control; technological information relating to data and information analysis in the field of the processing and analysis of pattern recognition data using artificial intelligence and natural language processing; technological information relating to data and information analysis in the field of personal concierge services for others via a mobile phonecomputertabletsmart phonehandheld computerportable computeradding and accessing calendar appointmentsalarmstimersreminders and making restauranttravelhotel reservations; technological information relating to data and information analysis in the field of personal information management; technological information relating to data and information analysis in the field of providing consumer assistant for searchinglocating and providing directions for the purchaseconsumption and use of a wide range of consumer productsservices and information over a global communications network; technological information relating to data and information analysis in the field of virtual computer systems and virtual computer environments through cloud computing; technological information relating to data and information analysis in the field of software development kits (SDKs) consisting of computer software for the developmentuseinteroperability of APIs that are used by electronic devicessystems; technological information relating to data and information analysis in the field of application programming interface (API) software with the function of integration of video content into websitesmonitoringautomating and scheduling of smart devices and access to a cloud service solutionhome and environmental monitoringcontrolautomation; technological information relating to data and information analysis in the field of air conditioning apparatuswater heaterslighting apparatus and freezing machines and apparatus; technological information relating to data and information analysis in the field of databasescomputer networks and the Internet; technological information relating to data and information analysis in the field of VLC (visible light communications) for the transmission of electronic datavideomusicimagetext and sound; technological information relating to data and information analysis in the field of cooking and household appliance use and operation downloadable software for home automation; technological information relating to data and information analysis in the field of household appliances; technological information relating to data and information analysis in the field of control of heatmoisture levelstiming of cooking processes and parametersincluding communicating various cooking instructions between computerscomputer networksperipheral communications devices; technological information relating to data and information analysis in the field of cooking instruction; technological information relating to data and information analysis in the field of cateringcookeryfood and drink; technological information relating to data and information analysis in the field of simulation of interior space design and planning; technological information relating to data and information analysis in the field of simulation of lighting planning; technological information relating to data and information analysis in the field of operation and control of water treatment systems; technological information relating to data and information analysis in the field of air contaminants and pollutants monitoring; technological information relating to data and information analysis in the field of visualization and analysis of air flow; technological advice relating to cloud computingcloud computing featuring temporary use of non-downloadable software for use in image recognitionretrieval and managementcloud computing featuring temporary use of non-downloadable software for database managementdata analysisdocument managementdocument analysisvideo managementanalysiscloud computingproviding virtual computer systems and virtual computer environments through cloud computingcloud computing featuring software for use in database managementfor use in retail inventory managementfor use as a spreadsheetfor word processing; technological advice relating to business information security and protection; information technology advice relating to Internet of Things (IoT); information technology advice relating to machine-to-machine (M2M) communication; information technology advice relating to digital content distribution; technological advice relating to identification and authentication of persons by means of cameras for iris recognition security or surveillance cameras; information technology advice relating to billing in electronic commerce transactions; technological information relating to remote video monitoring of babiesthe elderly and disabled; technological information relating to operation and control of industrial plant factory systems; technological information relating to operation and control of agricultural apparatus and systems; technological information relating to management and control of plant cultivation; technological information relating to operation and control of water treatment systems; technological information relating to monitoring of air contaminants and pollutants; technological information relating to visualization and analysis of air flow directionair flow patternair flow quantity and air flow characteristic; technological information relating to operation and control of autonomous-driving vehicles; design and development of computer systems for remote access to computer terminals and networksdesigndevelopment and maintenance of software related thereto; design and development of computer systems for scanningdetecting and eliminating of computer virusesspyware and malwaredesigndevelopment and maintenance of software related thereto; design and development of computer systems for searchanalysis and detection of security incidents and access logsdesigndevelopment and maintenance of software related thereto; design and development of computer systems for assessment of information computer systems security vulnerabilitydesigndevelopment and maintenance of software related thereto; design and development of computer systems for data and information analysisdesigndevelopment and maintenance of software related thereto; design and development of computer systems for cloud computingdesigndevelopment and maintenance of software related thereto; design and development of computer systems for sales managementdesigndevelopment and maintenance of software related thereto; design and development of computer systems for computer database searchesdesigndevelopment and maintenance of software related thereto; design and development of computer systems for providing storagearchivingbackupmanagement of electronic data via network connectiondesigndevelopment and maintenance of software related thereto; design and development of computer systems for detecting and analyzing the presence of individuals or objectsconsumer trends and consumer behaviordesigndevelopment and maintenance of software related thereto; design and development of computer systems for detecting and analyzing the locationstaying time and moving route of individuals or objectsdesigndevelopment and maintenance of software related thereto; design and development of computer systems for computer file managementdesigndevelopment and maintenance of software related thereto; design and development of computer systems for VLC (visible light communications) for the transmission of electronic datavideomusicimagetext and soundthe designdevelopment and maintenance of software related thereto; design and development of computer systems for Internet of Things (IoT)designdevelopment and maintenance of software related thereto; design and development of computer systems for machine-to-machine (M2M) communicationdesigndevelopment and maintenance of software related thereto; design and development of computer systems for video surveillancedesigndevelopment and maintenance of software related thereto; design and development of computer systems for text-to-speech convertingdesigndevelopment and maintenance of software related thereto; design and development of computer systems for remote video monitoringdesigndevelopment and maintenance of software related thereto; design and development of computer systems for management of customer informationdesigndevelopment and maintenance of software related thereto; design and development of computer systems for point-of-sales (POS) systemsdesigndevelopment and maintenance of software related thereto; design and development of computer systems for operation and control of industrial plant factory systemsdesigndevelopment and maintenance of software related thereto; design and development of computer systems for use in operation and control of water treatment systemsdesigndevelopment and maintenance of software related thereto; design and development of computer systems for monitoring of air contaminants and pollutantsdesigndevelopment and maintenance of software related thereto; design and development of computer systems for visualization and analysis of air flow in the field of heatventilation and air conditioningdesigndevelopment and maintenance of software related thereto; software as a service (SaaS) serviceshosting software for use by others for use for managing supply and demand chains in the retailgrocerywholesale distributionmanufacturingtraveltransportationhospitality and media industries; software as a service (SaaS) serviceshosting software for use by others for use in editingorganizing mininganalyzing and reporting business data used for managing and planning business operationsallocating business resourcestracking inventoryconducting customer resource managementevaluating pricing and revenue; software as a service (SaaS) serviceshosting software for use by others for managing production schedulesplanning and scheduling transportation shipments and overseeing and managing warehouse and shipping logistics; software as a service (SaaS) serviceshosting software for use by others for managingmininganalyzing and reporting business dataverifying pricesordering inventoryoperating retail stores and warehouses; software as a service (SaaS) serviceshosting software for use by others for accessing and transmitting retailer and supplier product data via a global computer network; software as a service (SaaS) services featuring software for predictive analysisbusiness data analysis and big dataprocessing and analyzing large volumes of dataall in business settings; software as a service (SaaS) services featuring software for programmingcontrolling and operating programmable controllers used in production lines; software as a service (SaaS) services featuring software for processing images and graphics; software as a service (SaaS) services featuring operating software for use with medical and beauty care apparatus; software as a service (SaaS) services featuring software for use in the transmission of data and information; software as a service (SaaS) services featuring software for use in customer relationship management; software as a service (SaaS) services featuring software used to monitor and control factory manufacturing processes; software as a service (SaaS) services featuring database management software for visible light communication; software as a service (SaaS) services featuring database management software for location information; software as a service (SaaS) services featuring software for energy management and monitoring; software as a service (SaaS) services featuring software for use in ensuring security of internet access; software as a service (SaaS) services featuring software for use in image recognitionsound recognitionvoice recognitioninternet securitytransmission of datadata miningdata querydata analysis and visualizing data; software as a service (SaaS) featuring software for programmingcontrolling and operating programmable controllers used in production lines; software as a service (SaaS) featuring software for processing images and graphics; SAAS services featuring operating software for use with medical and beauty care apparatus; software as a service (SaaS) featuring software for use in the transmission of data and information; software as a service (SaaS) featuring software for use in customer relationship management; software as a service (SaaS) service featuring software for image recognitionretrieval and management; software as a service (SaaS) featuring computer software for uploadingbrowsingviewingclassifyingmanaging and sharing digital videoimage or documents; platform as a service (PAAS) services featuring a software platform for uploadingbrowsingviewingclassifyingmanaging and sharing digital videoimage or documents; software as a service (SaaS) serviceshosting software for use by others in the field of information security and for the encryptiondecryption and authentication of datafor digital certificate issuanceverificationmanagementfor the verification and management of digital keys and credentials; software as a service (SaaS) services featuring computer software for remote monitoring of the functioning and use of air conditioning apparatuswater heaterslighting apparatus and freezing machines and apparatus; software as a service (SaaS) services featuring computer software for enable connection to databasescomputer networks and the Internet; software as a service (SaaS) services featuring computer software for use in the field of VLC (visible light communications) for the transmission of electronic datavideomusicimagetext and sound; software as a service (SaaS) services featuring computer software in the fields of cooking and household appliance use and operation downloadable software for home automation; software as a service (SaaS) services featuring computer software for controlling household appliances; software as a service (SaaS) services featuring computer software for use in controlling heatmoisture levelstiming of cooking processes and parametersincluding communicating various cooking instructions between computerscomputer networksperipheral communications devices; software as a service (SaaS) services featuring computer software for use in connection with cooking instruction; software as a service (SaaS) services featuring computer software for mobile phoneseducational software featuring instruction in the field of cateringcookeryfood and drink; software as a service (SaaS) services featuring software for simulation of interior space design and planning; software as a service (SaaS) services featuring software for simulation of lighting planning; software as a service (SaaS) services featuring software for operation and control of water treatment systems; software as a service (SaaS) services featuring software for monitoring air contaminants and pollutants; software as a service (SaaS) services featuring software for visualization and analysis of air flow; software as a service (SaaS) featuring software for management and control of mobile computer or communication devices; software as a service (SaaS) featuring software for data storage management; software as a service (SaaS) featuring software for scanningdetecting and eliminating of virusesspyware and malware; software as a service (SaaS) featuring software for data and information analysis; software as a service (SaaS) featuring software for cloud computing; software as a service (SaaS) featuring software for sales management; software as a service (SaaS) featuring software for client and customer management; software as a service (SaaS) featuring software for detecting and analyzing the presence of individuals or objects; software as a service (SaaS) featuring software for detecting and analyzing the locationstaying time and moving route of individuals or objects; software as a service (SaaS) featuring software for internet of things (IoT); software as a service (SaaS) featuring software for machine-to-machine (M2M) communication; software as a service (SaaS) featuring software for digital content distribution; software as a service (SaaS) featuring software for text-to-speech converting; software as a service (SaaS) featuring software for computerized production management; software as a service (SaaS) featuring software for remote video monitoring; software as a service (SaaS) featuring software for management of customer information; software as a service (SaaS) featuring software for point-of-sales (pos) systems; software as a service (SaaS) featuring software for virtual reality image processing; software as a service (SaaS) featuring software for use in processingstoring and accessing information of faces in order to verify and identify the persons in the field of personal authentication; software as a service (SaaS) featuring software for use in face recognition; software as a service (SaaS) services featuring software for management and control of mobile computer or communication devices; software as a service (SaaS) services featuring software for data storage management; software as a service (SaaS) services featuring software for scanningdetecting and eliminating of virusesspyware and malware; software as a service (SaaS) services featuring software for data and information analysis; software as a service (SaaS) services featuring software for cloud computing; software as a service (SaaS) services featuring software for sales management; software as a service (SaaS) services featuring software for client and customer management; software as a service (SaaS) services featuring software for detecting and analyzing the presence of individuals or objects in the nature of consumer trends and consumer behavior; software as a service (SaaS) services featuring software for detecting and analyzing the locationstaying time and moving route of individuals or objects; software as a service (SaaS) services featuring software for Internet of Things (IoT); software as a service (SaaS) services featuring software for machine-to-machine (M2M) communication; software as a service (SaaS) services featuring software for digital content distribution; software as a service (SaaS) services featuring software for text-to-speech converting; software as a service (SaaS) services featuring software for computerized production management; software as a service (SaaS) services featuring software for remote video monitoring; software as a service (SaaS) services featuring software for management of customer information; software as a service (SaaS) services featuring software for point-of-sales (POS) systems; software as a service (SaaS) services featuring software for virtual reality image processing; software as a service (SaaS) services featuring software for use in operation and control of water treatment systems; software as a service (SaaS) services featuring software for monitoring of air contaminants and pollutants; software as a service (SaaS) services featuring software for visualization and analysis of air flow directionair flow of patternsair flow quality and air flow characteristics; analysis of the performance of computer systems composed of computer databases; cloud computing featuring temporary use of non-downloadable software for use in image recognitionretrieval and management; cloud computing featuring temporary use of non-downloadable software for database managementdata analysisdocument managementdocument analysisvideo managementanalysis; cloud computingproviding virtual computer systems and virtual computer environments through cloud computing; cloud computing featuring software for use in database managementfor use in retail inventory managementfor use as a spreadsheetfor word processing; computer servicesproviding an online search engine for videoimagedocument and other data via the cloud database to view digital evidence and upload evidencelog eventsbookmark and classify incidents captured in the foregoing files; providing computer programs on data networksproviding temporary use of online non-downloadable software for remotely monitoring environment and condition and controlling devices within a buildingfacility and designated separate area; providing computer programs on data networksproviding temporary use of online non-downloadable software for remotely controlling lighting devices within a buildingfacilities and designated separate area; providing computer programs on data networksproviding temporary use of online non-downloadable software for the purpose of remotely monitoring and controlling electric appliance; providing computer programs on data networksproviding temporary use of online non-downloadable software for displaying advertisement; providing computer programs on data networksproviding temporary use of online non-downloadable software for proposing adequate operation candidate of electric appliance; providing computer programs on data networksproviding temporary use of online non-downloadable software for use to connect and control internet of things (Iot) electronic devices; providing computer programs on data networksproviding temporary use of online non-downloadable software for image processing used for mobile phones; providing computer programs on data networksproviding temporary use of online non-downloadable software for accessing and using the internet; providing computer programs on data networksproviding temporary use of online non-downloadable software for enabling access or entrance control; providing computer programs on data networksproviding temporary use of online non-downloadable software for the processing and analysis of pattern recognition data using artificial intelligence and natural language processing; providing computer programs on data networksproviding temporary use of online non-downloadable software for providing personal concierge services for others via a mobile phonecomputertabletsmart phonehandheld computerportable computeradding and accessing calendar appointmentsalarmstimersreminders and making restauranttravelhotel reservations; providing computer programs on data networksproviding temporary use of online non-downloadable software for personal information management; providing computer programs on data networksproviding temporary use of online non-downloadable software for providing consumer assistant for searchinglocating and providing directions for the purchaseconsumption and use of a wide range of consumer productsservices and information over a global communications network; consultancy services in the field of cloud computing; scanning of documents for digitization; infrastructure as a service (IaaS) serviceshosting servers for use by others; hosting of computer servers; design and development of computer databases; hosting of computer databasesserver memory space; electronic storage of archived data; computer security consultancy services in the field of firewalls; technical verification and validation of product operationperformance testing of product; technical verification and validation of computer networks; technical verification and validation of computer systems; new product design services; product design and development services in the field of semiconductoraudiovisual equipment; designing of machinesapparatusinstrumentsincluding their partssystems composed of such machinesapparatus and instruments; quality control services in the field of analysis and evaluation of products; quality control in the field of structural analysis and evaluation of buildings; material testing and analyzing; chemical testinganalysis and evaluation services; testing and analysis of communication network connection; consultancy relating to research and development of products in the field of electric machinery and electronics; technical inspection servicesin the field of product quality controlgeological mining; consultancy relating to designprogramming and maintenance of computer software; creating and maintaining web sites for others; rental of computer software for playing gamesediting digital photos; technical consultancy relating to the design of computer hardwaresoftware and computer peripherals; provision of technical information in relation to computers; providing a web hosting platform for process automation in manufacturing; providing a web hosting platform for processing images and graphics; providing a web hosting platform for providing multimedia entertainment; providing a web hosting platform for customer relationship management; providing a web hosting platform for monitoring and controlling factory manufacturing processes; providing a web hosting platform for managing and controlling beacon-based location systems and information; providing a web hosting platform for retail inventory management; platform as a service (PaaS) featuring computer software platforms for use in image recognitionsound recognitionvoice recognitioninternet securitytransmission of datadata miningdata querydata analysis and visualizing data; Platform as a Service (PAAS) featuring non-downloadable software that enables users to requestshareuploadviewdiscoveranalyze data and information obtained from electronic devices; installation of computer software; design of telecommunication machines and apparatus and radio communication machines and apparatusconsultancy relating to such design; design and development of computer hardwaresoftware and databases; rental of memory space for servers on the Internet; rental of computer servers; rental of measuring apparatus and instrumentssemiconductor testing apparatus; rental of measuring apparatus; rental of laboratory apparatus and instruments; rental of technical drawing instruments; engineering of measuring and testing apparatus and instruments; design of measuring and testing apparatus and instruments; design and development of navigation systems; architectural research; research on urban planning; testing and research in the field of prevention of pollution; scientific research; conducting technical project studies in the field of electricalelectronicmechanical and environmental engineeringenergy and power needs of others and power and energy supply; research and development of new products for others; testing and research in the field of electricity; machinery testing and research; testing and research in the field of civil engineering; conducting technical surveys on energy consumption and providing information thereof; consultancy and information in the field of energy saving and efficiency; surveying; architectural services; construction drafting; architectural consultation; providing information in the field of architectural design; geological surveys and research; design of building interiors and exteriors; monitoring of computer systems by remote access; industrial design; quality control for others; consulting services in the field of environmental assessment and planning services; environmental monitoring services; research in the field of environmental conservation and protection; providing technological information about environmentally conscious and green innovations; environmental testing and inspection services; engineering services in the field of environmental technology; technical consultancy in the field of environmental science; product design services in the field of environmental technology; providing information and consultancy relating to all the aforesaid services

Publicações

Histórico de despachos e eventos da marca no USPTO.

68 publicações encontradas

INPR

PARTIAL INVALIDATION OF REG EXT PROTECTION CREATED

08/08/2026

LIMN

LIMITATION FROM THE IB EXAMINED, NO ACTION IS NEEDED

13/07/2026

NURC

NOTICE OF UPDATED REGISTRATION CONFIRMATION EMAILED

10/03/2026

FINO

FINAL DECISION TRANSACTION PROCESSED BY IB

19/02/2026

COC.

CORRECTION UNDER SECTION 7 - PROCESSED

16/02/2026

APRE

CASE ASSIGNED TO POST REGISTRATION PARALEGAL

16/02/2026

FICS

FINAL DISPOSITION NOTICE SENT TO IB

30/01/2026

FIMP

FINAL DISPOSITION PROCESSED

29/01/2026

NURC

NOTICE OF UPDATED REGISTRATION CONFIRMATION EMAILED

30/12/2025

XXXX

POST REGISTRATION ACTION CORRECTION

09/12/2025

CORN

CORRECTION FROM THE IB EXAMINED, NO ACTION IS NEEDED

13/11/2025

FICR

FINAL DISPOSITION NOTICE CREATED, TO BE SENT TO IB

08/10/2025

APRE

CASE ASSIGNED TO POST REGISTRATION PARALEGAL

06/10/2025

CORN

CORRECTION FROM THE IB EXAMINED, NO ACTION IS NEEDED

27/08/2025

CHPN

POST PUBLICATION AMENDMENT – NOT ENTERED

30/07/2025

APET

ASSIGNED TO PETITION STAFF

28/07/2025

ES7R

TEAS SECTION 7 REQUEST RECEIVED

11/07/2025

NRCC

NOTICE OF REGISTRATION CONFIRMATION EMAILED

08/07/2025

R.PR

REGISTERED-PRINCIPAL REGISTER

08/07/2025

ETOP

EXTENSION OF TIME TO OPPOSE PROCESS - TERMINATED

15/06/2025

EPPA

TEAS POST PUBLICATION AMENDMENT RECEIVED

02/06/2025

CRCV

CORRECTION TRANSACTION RECEIVED FROM IB

03/05/2025

LIMG

LIMITATION OF GOODS RECEIVED FROM IB

03/05/2025

LIME

LIMITATION FROM THE IB - REQUEST EXAM REVIEW

17/04/2025

CRCV

CORRECTION TRANSACTION RECEIVED FROM IB

04/04/2025

ETOF

EXTENSION OF TIME TO OPPOSE RECEIVED

05/03/2025

NPUB

OFFICIAL GAZETTE PUBLICATION CONFIRMATION E-MAILED

04/02/2025

PUBO

PUBLISHED FOR OPPOSITION

04/02/2025

NONP

NOTIFICATION OF NOTICE OF PUBLICATION E-MAILED

29/01/2025

CNSA

APPROVED FOR PUB - PRINCIPAL REGISTER

14/01/2025

XAEC

EXAMINER'S AMENDMENT ENTERED

14/01/2025

GNEN

NOTIFICATION OF EXAMINERS AMENDMENT E-MAILED

14/01/2025

GNEA

EXAMINERS AMENDMENT E-MAILED

14/01/2025

CNEA

EXAMINERS AMENDMENT -WRITTEN

14/01/2025

TEME

TEAS/EMAIL CORRESPONDENCE ENTERED

07/11/2024

CRFA

CORRESPONDENCE RECEIVED IN LAW OFFICE

07/11/2024

ERFR

TEAS REQUEST FOR RECONSIDERATION RECEIVED

07/11/2024

OPNX

NOTIFICATION OF POSSIBLE OPPOSITION - PROCESSED BY IB

02/11/2024

OPNS

NOTIFICATION OF POSSIBLE OPPOSITION SENT TO IB

16/10/2024

LIMG

LIMITATION OF GOODS RECEIVED FROM IB

02/08/2024

GNS1

NOTIFICATION OF SUBSEQUENT FINAL EMAILED

09/05/2024

GNSF

SUBSEQUENT FINAL EMAILED

09/05/2024

CFRC

SUBSEQUENT FINAL REFUSAL WRITTEN

09/05/2024

ZZZX

PREVIOUS ALLOWANCE COUNT WITHDRAWN

02/05/2024

PBCR

WITHDRAWN FROM PUB - OG REVIEW QUERY

23/04/2024

CNSA

APPROVED FOR PUB - PRINCIPAL REGISTER

05/04/2024

XAEC

EXAMINER'S AMENDMENT ENTERED

05/04/2024

GNEN

NOTIFICATION OF EXAMINERS AMENDMENT E-MAILED

05/04/2024

GNEA

EXAMINERS AMENDMENT E-MAILED

05/04/2024

CNEA

EXAMINERS AMENDMENT -WRITTEN

05/04/2024

ZZZX

PREVIOUS ALLOWANCE COUNT WITHDRAWN

05/04/2024

GNFN

NOTIFICATION OF FINAL REFUSAL EMAILED

14/03/2024

GNFR

FINAL REFUSAL E-MAILED

14/03/2024

CNFR

FINAL REFUSAL WRITTEN

14/03/2024

TEME

TEAS/EMAIL CORRESPONDENCE ENTERED

12/02/2024

CRFA

CORRESPONDENCE RECEIVED IN LAW OFFICE

12/02/2024

TROA

TEAS RESPONSE TO OFFICE ACTION RECEIVED

12/02/2024

RFNT

REFUSAL PROCESSED BY IB

13/09/2023

RFCS

NON-FINAL ACTION MAILED - REFUSAL SENT TO IB

12/08/2023

RFRR

REFUSAL PROCESSED BY MPU

11/08/2023

CRSN

CORRECTION SENT TO IB

09/08/2023

CRCR

CORRECTION CREATED FOR IB

08/08/2023

RFCR

NON-FINAL ACTION (IB REFUSAL) PREPARED FOR REVIEW

07/07/2023

CNRT

NON-FINAL ACTION WRITTEN

06/07/2023

DOCK

ASSIGNED TO EXAMINER

27/06/2023

MAFR

APPLICATION FILING RECEIPT MAILED

23/05/2023

NWOS

NEW APPLICATION OFFICE SUPPLIED DATA ENTERED

19/05/2023

REPR

SN ASSIGNED FOR SECT 66A APPL FROM IB

18/05/2023

Proteção contínua da sua marca

Seja avisado a cada novo depósito que ameace LIVE YOUR BEST ou a sua marca.

Vigilância profissional por 24 meses: monitoramos o USPTO por você e alertamos a tempo de você se opor — antes que o conflito vire prejuízo.