Classe 9
Downloadable or recorded or stored on digital storage media computer software for accessing or using or providing online or web based services being or relating to marketingadvertisingpromotionbusiness organization and managementbusiness administrationbusiness assistancebusiness communicationsbusiness privacy and securityoffice functionshuman resourcesfinancial operationsaccountancybusiness planningbusiness informationbusiness advice and consultancymarket researchbusiness networkingpublic relationssocial mediaweb content managemente-commercesearch facilitieswebsite and web page designdevelopmenthosting and management; Apparatus and instruments for recordingtransmissionreceptionprocessingretrievalreproductionmanipulationanalysisdisplay and print-out of soundimagesvideo and/or datadevices and equipment being playersstreaming devicesset-top boxesrecordersPVRsbroadcasting and receiving equipmentdigital camerasmemory and storage devicesstorage drivestransducersediting equipmentgames consoles and game-playing equipmentdisplaysscreens and screen-containing devicesprintersall being for recordingstoringeditingplaying-backplayingstreaming and displaying of audio and video datasignals and content; Digital communications apparatusinstruments and hardwaretelephonesmobile phonesmobile devices being data receiverstabletstablet computersnotebook computerspersonal digital assistantslaptop computersportable computersdesktop computerswireless communications devices and wireless adapters used to link items of electronic or digital devices and equipment to each other wirelessly or to a telecommunications networknear-field communication (NFC) technology-enabled devices being telephonesmobile phonesmobile devices being data receiverstabletstablet computersnotebook computerspersonal digital assistantslaptop computersportable computersdesktop computersplayersstreaming devicesset-top boxesrecordersPVRsbroadcasting and receiving equipmentdigital camerasmemory and storage devicesstorage drivestransducersediting equipmentgames consoles and game-playing equipmentdisplaysscreens and screen-containing devicesprintersmodemsnetwork or telecommunications routersdongles being wireless adaptorspower and data-transfer cables for use with any of the aforesaid goods; Telecommunications apparatusequipment and hardwaretelephonesmobile phonesmobile devices being data receiverstabletstablet computersnotebook computerspersonal digital assistantslaptop computersportable computersdesktop computerswireless telecommunications devices and wireless adapters used to link items of electronic or digital telecommunications devices and equipment to each other wirelessly or to a telecommunications networkwireless adapters used to link computers and telecommunications devices to a telecommunications networknear-field communication (NFC) technologyenabled telecommunications devices being telephonesmobile phonesmobile devices being data receiverstabletstablet computersnotebook computerspersonal digital assistantslaptop computersportable computersdesktop computersplayersstreaming devicesset-top boxesrecordersPVRsbroadcasting and receiving equipmentdigital camerasmemory and storage devicesstorage drivestransducersediting equipmentgames consoles and game-playing equipmentdisplaysscreens and screen-containing devicesprinterstelecommunications modems and routers and dongles being wireless adaptorspower and data-transfer cables for use with any of the aforesaid goods; Computer and mobile device hardware and downloadable or recorded or stored on digital storage media software for making and processing payment transactions with credit cardsdebit cardsgift cardscashother payment forms; Downloadable or recorded or stored financial software for carrying out financial operations and processesfor accountancy and for use in association with mobile devicescash registers and other point of sale systems for carrying out financial operations with same; Downloadable or recorded or stored on digital storage media ecommerce software to allow users to perform electronic business transactions; Computer and mobile device hardware and downloadable or recorded or stored on digital storage media software that provides analytic tools for payment processingto createmanage and optimise customer relationships and loyalty programsfor business optimisation; Mobile communications devicesmobile telephonesmobile computerslaptop computerstablet computersnotebook computerspersonal digital assistants; Wearable activity trackers; Wearable computer devices in the nature of wearable computers being smartwatchesfitness trackershealth monitorsvirtual reality headsetssmart jewelleryinternet-enabled glasseswirelessenabled headsets and headphones; Wearable computer peripheral devices in the nature of wearable data input devices being smartwatchesfitness trackershealth monitorsvirtual reality headsetssmart jewelleryinternet-enabled glasseswirelessenabled headsets and headphones; Wearable data and video display devicesdata and video display screens and data and video display monitors; Wearable communications devices in the nature of wearable telephone deviceswearable personal digital assistantswearable wireless communications devices and wearable wireless adapters used to link items of wearable electronic or digital devices and equipment to each other wirelessly or to a telecommunications network; Data processing apparatus; Downloadable or recorded or stored on digital storage media mobile device application software and apps for accessing or using or providing online or web-based services being or relating to marketingadvertisingpromotionbusiness organisation and managementbusiness administrationbusiness assistancebusiness communicationsbusiness privacy and securityoffice functionshuman resourcesfinancial operations and processesaccountancybusiness planningbusiness informationbusiness advice and consultancymarket researchbusiness networkingpublic relationssocial mediaweb content managementecommercesearch facilitieswebsite and web page designdevelopmenthosting and management; Downloadable computer software for accessing or using or providing online or web-based services being or relating to marketingadvertisingpromotionbusiness organisation and managementbusiness administrationbusiness assistancebusiness communicationsbusiness privacy and securityoffice functionshuman resourcesfinancial operations and processesaccountancybusiness planningbusiness informationbusiness advice and consultancymarket researchbusiness networkingpublic relationssocial mediaweb content managemente-commercesearch facilitieswebsite and web page designdevelopmenthosting and management; Downloadable mobile device application software and apps for accessing or using or providing online or web-based services being or relating to marketingadvertisingpromotionbusiness organisation and managementbusiness administrationbusiness assistancebusiness communicationsbusiness privacy and securityoffice functionshuman resourcesfinancial operations and processesaccountancybusiness planningbusiness informationbusiness advice and consultancymarket researchbusiness networkingpublic relationssocial mediaweb content managemente-commercesearch facilitieswebsite and web page designdevelopmenthosting and management; Downloadable web applications software for accessing or using or providing online or web-based services being or relating to marketingadvertisingpromotionbusiness organization and managementbusiness administrationbusiness assistancebusiness communicationsbusiness privacy and securityoffice functionshuman resourcesfinancial operations and processesaccountancybusiness planningbusiness informationbusiness advice and consultancymarket researchbusiness networkingpublic relationssocial mediaweb content managemente-commercesearch facilitieswebsite and web page designdevelopmenthosting and management; Downloadable website personalisation software for customising websites and website content; Downloadable online marketplace software for accessingusingoperating and managing online marketplaces; Downloadable trading software for accessingusingoperating and managing digital trading platformssystems and facilities; Downloadable marketing software for accessingusingoperating and managing digital marketing platformssystems and facilities; Downloadable advertising software for accessingusingoperating and managing advertising platformssystems and facilities; Downloadable directory software for accessingusingoperating and managing digital directories and databases; Downloadable e-commerce software for accessingusingoperating and managing ecommerce platformssystems and facilities; Downloadable database management software; Downloadable customer and client review management software; Downloadable business software for accessing or using or providing online or web-based services being or relating to marketingadvertisingpromotionbusiness organization and managementbusiness administrationbusiness assistancebusiness communicationsbusiness privacy and securityoffice functionshuman resourcesfinancial operations and processesaccountancybusiness planningbusiness informationbusiness advice and consultancymarket researchbusiness networkingpublic relationssocial mediaweb content managemente-commercesearch facilitieswebsite and web page designdevelopmenthosting and management; Downloadable training and education software for accessingusingoperating and managing online or digital training and education materialsplatforms and facilities; Downloadable or recorded or stored on digital storage media computer software development tools; Downloadable reporting and analytics software for data analysis and data reporting purposes for use in relation to marketing and sales and business and financial data; Downloadable collaborative software for enabling individuals or teams to work togethershare information and knowledgeshare documents and datacommunicate with each other in real time via a centralised platform; Downloadable price comparison software; Downloadable accounting software; Downloadable price or fee quoting software; Downloadable invoicing software; Downloadable payment software for making and processing electronic payments; Downloadable sales management software for managing and optimising sales of products and services; Downloadable inventory management software; Downloadable software using machine learningdeep learning and artificial intelligence for optimising advertisingmarketingpromotion and sales of products and services; Downloadable neuromarketing software for optimising advertisingmarketingpromotion and sales of products and services; Downloadable automation software for automating processes in business and commercial operations; Downloadable blockchain software for effectingverifyingrecording and managing transactions in a blockchain; Downloadable decentralised applications softwarefor running on a blockchain or peer-to-peer computer networkfor accessing or using or providing online or web-based services being or relating to marketingadvertisingpromotionbusiness organisation and managementbusiness administrationbusiness assistancebusiness communicationsbusiness privacy and securityoffice functionshuman resourcesfinancial operations and processesaccountancybusiness planningbusiness informationbusiness advice and consultancymarket researchbusiness networkingpublic relationssocial mediaweb content managemente-commercesearch facilitieswebsite and web page designdevelopmenthosting and management; Downloadable quantum processing softwarefor implementing quantum algorithms using quantum circuitsfor accessing or using or providing online or web-based services being or relating to marketingadvertisingpromotionbusiness organisation and managementbusiness administrationbusiness assistancebusiness communicationsbusiness privacy and securityoffice functionshuman resourcesfinancial operations and processesaccountancybusiness planningbusiness informationbusiness advice and consultancymarket researchbusiness networkingpublic relationssocial mediaweb content managemente-commercesearch facilitieswebsite and web page designdevelopmenthosting and management; Downloadable privacy software for protecting the privacy of a user's information and datafor protecting the privacy of a user's location and activity whilst using the internet; Downloadable security software for protecting and securing computerscomputer systems and networks and mobile devices from unauthorized accessintrusionsvirusesother threatsfor maintaining the security of personal and business information and data; Downloadable communications software for enabling communications between computerscomputer systems and networks and mobile devicesfor enabling communications between users using computerscomputer systems and networks and mobile devices; Downloadable e-mailtextSMS and messaging software for sendingreceiving and managing e-mailstextsSMS and other electronic messages; Downloadable chatchat-roomelectronic bulletin board and discussion forum software for accessing or using or providing online or web-based chatchat-roomelectronic bulletin board and discussion forum services; Downloadable voice over internet protocol (VOIP) software for making audio and/or video calls over the internet; Downloadable voice search software for enabling a user to use a voice command to perform a search on the internet or a website or during use of a software application; Downloadable visual search software for enabling a user to conduct a search on the internet or a website using a visual image or visual content; Downloadable domain management software for managing a portfolio of domain namesmaintaining registrations of domain names and maintaining and managing ongoing security and performance of domains; Downloadable image management software; Downloadable image processing software; Downloadable copywriting software for writing and composing advertising and marketing copy; Downloadable social software of the nature of communication and interactive tools software for accessingusingoperating and managing social and interactive media and content; Downloadable social networking software for accessingusingoperating and managing social networking platformsforums and facilities and social networking accounts and content; Downloadable chat and chatbot software for simulating human-like conversations with usersthrough text or voice interactionsvia online chat facilities; Downloadable conversational marketing software for simulating personalisedone-to-one conversations with usersthrough text or voice interactionsfor marketing purposes; Downloadable influencer marketing software for assisting marketers to findengage with and make deals with social media influencers; Downloadable social software applications of the nature of communication and interactive tools software applications for accessingusingoperating and managing social and interactive media and content; Downloadable video software for creatingediting and modifying video content and production of video material and content; Downloadable GPS software for navigation purposes and for use with GPS navigation devices and equipment; Downloadable mapping software for enabling users to mapmodelquery and analyse data according to their locationto create maps that integrate information from multiple sources for enabling visualisation of patterns and understanding of how geography affects their business and sales and marketing strategies and operations; Downloadable navigationguidancetrackingtargeting and map making software; Downloadable augmented reality software for integrating computer-generated digital content into a user's environment to provide a composite experience that combines the real world and computer-generated content; Downloadable virtual reality software for creating an artificial computer-generated environment with which a user can interact in a way that simulates reality; Downloadable computer games programs and computer games software; Downloadable software for accessingbrowsing and searching online databases; Downloadable software for enabling searching and retrieval of data; Downloadable search engine software; Downloadable customer relationship management (CRM) software; Downloadable content management system (CMS) software; Downloadable software for designingdevelopinghosting and managing websites and web pages; Downloadable software for designingdevelopinghosting and managing website landing pages; Downloadable automated website and web page design and development software; Downloadable automated website landing page design and development software; Downloadable editing software for editing audiovideophotographicgraphicstext and document filesmedia and content; Downloadable customisation software for customising software to perform tasks specific to the specific requirementsneedsoperations or practices of a specific user or organisation or set or group of users or organisations; Downloadable updating software for updating computer and mobile device software and apps; Downloadable software for trackingmonitoringmeasuringrecording and analysing internet and website traffic; Downloadable software for recordingdisplayingmanaging and sharing textdatagraphicsimagesaudiovideoother multimedia content; Downloadable software applications for sharingpublishingrecordinguploadingdisplayingviewingmanaging and transmitting digital contentincluding photosvideosblog posts and articlesto wireless devices and communications networks; Downloadable software for providing consumer informationincluding rankingsratingsreviewsreferrals and recommendations in relation to businesses and service providers; Downloadable computer softwaremobile device software and appsall for use in the makingreceiving or processing of electronic payments; Downloadable computer softwaremobile device software and appsall for use in accessing online or web-based services being or relating to marketingadvertisingpromotionbusiness organization and managementbusiness administrationbusiness assistancebusiness communicationsbusiness privacy and securityoffice functionshuman resourcesfinancial mattersaccountancybusiness planningbusiness informationbusiness advice and consultancymarket researchbusiness networkingpublic relationssocial mediaweb content managemente-commercesearch facilitieswebsite and web page designdevelopmenthosting and management; Downloadable computer softwaremobile device software and appsall for use in accessing or using or providing services being or relating to marketingadvertisingpromotionbusiness organisation and managementbusiness administrationbusiness assistancebusiness communicationsbusiness privacy and securityoffice functionshuman resourcesfinancial mattersaccountancybusiness planningbusiness informationbusiness advice and consultancymarket researchbusiness networkingpublic relationssocial mediaweb content managemente-commercesearch facilitieswebsite and web page designdevelopmenthosting and management; Recorded or stored on digital storage media or downloadable computer and electronic databases relating to data in businessindustrytradingfinancepersonalsocial or legal fields; Recorded or stored on digital storage media or downloadable electronic publications in the form of booksmagazinesperiodicalsdrawingsmanualsbrochurescataloguesinformation sheetsnewslettersdirectoriescircularsflyersadvertisements and other information-containing and promotional documentsall relating to businessindustrytradingfinancepersonalsocial or legal fields; Recorded or stored on digital storage media or downloadable electronic documentsfilesmedia and content featuring documentsfilesmedia and content relating to businessindustrytradingfinancepersonalsocial or legal fields.
Classe 35
Marketing and advertising; Digital advertising services; Digital marketing services; Search engine advertising services; Pay-per-click marketing services; Search engine optimisation for improving website visibility and rankings in search engines; Website optimisation for increasing website traffic and website visibility by search engines; Website traffic optimisation; Local search engine optimisation for promoting sales to local customers and clients; Producing advertising material and content for othersproducing video advertising for commercial and promotional use; Production of advertising films; Production of audio and/or video material and content for advertising and promotional purposes; Production of advertising material; Mobile advertising services for others; Producing personalised or customised advertising; Relationship marketing services; Display advertisingdissemination of advertising for others via computer or telecommunications networks for display on computer screens and mobile devices; Content marketing services; Affiliate marketing services; Referral marketing services; Influencer marketing services; Remarketing servicestargeted marketing services; Email marketing services; Automated marketing services; Social advertising servicesadvertising services provided by means of social media; Programmatic advertising services; Virtual reality advertising services; Actual reality advertising services; On-demand and streaming service advertising servicesadvertising services provided via on-demand and streaming services; Digital application advertising servicesadvertising services provided via digital applications; Aggregator advertising servicesadvertising services involving the gathering of related advertising content from multiple online sources and displaying it to a user in a single location; Blog and vlog advertising servicesnamely advertising services provided via blogs and vlogs; E-books advertising servicesadvertising services in the field of e-books; Forum advertising servicesadvertising services provided by means of online forums; Gaming advertising servicesadvertising services provided by means of online games; Interstitial advertising servicesadvertising services provided by means of interstitial advertisements placed within or in transitions of content in websitesappsvideosgames and online content; Infographic advertising servicesadvertising services provided by means of infographic advertisements placed in websitesappsvideosgames and online content; Near-field communication (NFC) advertising servicesadvertising services involving placement of short-range wireless connectivity technology at locations or in objects for interacting with nearby devices for placing advertisements thereon; Digital signage advertising services in the nature of providing electronic billboards and digital signs for the display of advertising material thereon; Audio and podcast advertising servicesadvertising services involving placement of advertisements in audio content and podcasts; Advertising services using automationmachine learningdeep learningartificial intelligenceneuromarketing and quantum processing; Advertising services involving placement of advertisements in blockchain and decentralised applications; Traditional advertising servicesadvertising services provided by means of printclassifiedtelevisionfilmcinemaradiobillboard and signagepoint-of-sale (POS)packagingpostalexhibitionevent and trade fairswearable; Advertising and promotion services by means of advertorials; Public relations; Press release management services; Promotional marketing services; Product marketing servicesmarketing of products of others; Services marketing servicesmarketing of services of others; Professional services promotional servicespromoting and marketing professional services of others; Sales promotion for others; Advertising services to create brand identities for others; Brand creation servicesnamely brand concept design and brand development services for creating brands and brand identities for others; Brand strategy and brand development services; Brand consultancy services; Online advertising services on a computer network; Rental or leasing of advertising space; Marketing research; Marketing assistance; Business marketing assistance; Business management servicesreview management in the nature of monitoringanalysing and responding to or acting on customer or client reviews; Promotion and advertising of goods and services through sponsorship of businessindustrialeducationalsportingsocial and cultural eventsactivities and establishments; Management of sponsorship of businessindustrialeducationalsportingsocial and cultural eventsactivities and establishments for promotional or advertising purposes; Business management servicespartner management services; Market survey and opinion polling managementmarket researchmarket analysismarket assessmentmarket forecasting and market reporting in relation to businesses and service providers; Business adviceplanning and consultancy; Business management and administration assistance; Business management of client or customer referral schemes and referral programmes; Business networking services; Organisation and putting on of business networking events for enabling people to promote their own products and services to others; Organisation and putting on of trade fairs; Provision of business information; Business administration services; Business administration assistance services; Providing office functions; Diary functionsoperating a diary system for monitoringreminding ofacting on or attending to datesappointmentsmeetingstasksjobs and reminders therefor; Providing office functionsappointment arranging and scheduling services; Providing office functionsappointment reminder and confirmation services; Data processing services; Accountancy services; Business administration processing services in relation to invoicesquotes and payments; Auctioneering; Business researchbusiness auditingbusiness forecastingbusiness appraisalsbusiness acquisition searches and business acquisitions consultancy services; Business project management services; Sponsorship searching services; Human resource management and personnel recruitment services; Personnel management; Provision of contract sales forces in the nature of providing temporary or permanent sales personnel on contract; Provision of commission sales staff in the nature of providing temporary or permanent sales personnel on commission; Payroll preparation; Book-keeping and accounting services; Tax and tax return filing services; Tax and tax return preparation; Inventory control and management; Stenographic transcription servicesservices of transcription of meetingsinterviews and events; Audio transcription services; Message transcription services; Telephone answering services; Telephone switchboard services; Copywriting and scriptwriting services for advertising and promotional purposes; Market survey and opinion polling management services; Recruitment advertising services in the nature of advertising for the purpose of personnel recruitment; Dissemination of marketing material; Rental of advertising space on websitesonline forums and platformsin computer software and mobile device appson vehiclesbillboardssignsprinted publicationsprinted material and physical media; Rental of advertising material in the nature of advertisements and advertising content for placement on websitesonline forums and platformsin computer software and mobile device appson vehiclesbillboardssignsprinted publicationsprinted material and physical media; Market researchmarket analysismarket assessmentmarket forecasting and market reporting services in relation to businesses and service providers; Provision of consumer product and client service recommendationsratings and feedback; Providing commercial information and advice for consumers in the choice of products and services; Market research studies; Compilation of statistics; Web indexing for commercial or advertising purposescompiling indexes of website-based or online information for commercial or advertising purposes.
Classe 36
Payment processing services in the fields of payments by credit and debit cardspayments via online accountsbank and other financial institution accountsby mobile-device and app-based payment systems; payment processing services for the processing of payments of taxinsuranceaccountsbillsinvoicessubscriptionsfees and monetary sums; Electronic and online payment services for the payment of accountsbillsinvoicessubscriptionsfees and monetary sums; Automated payment services for the automated payment of accountsbillsinvoicessubscriptionsfees and monetary sums; Processing of debit or credit card paymentsof electronic or mobile-device or app-based payments; Contactless payment servicesprocessing of contactless payments made by debit or credit cards and by mobile-devices and apps; Financial prepayment servicesproviding and operating prepaid accountsprepaid online accounts and prepaid cards for subsequently funding and making payments therefrom; Financial sponsorship of businessindustrialeducationalsportingsocial and cultural eventsactivities and establishments; Financial management services; Financial management of advertising and marketing accountsbudgets and spends; Financial servicesfinancial adviceinformationforecastingvaluation of personal and real property and assets and possessionsanalysisappraisal and reporting servicesfinancial consultancy servicesfinancial planning servicesbanking and clearing servicesfinancing servicesloan and credit servicesfinancial brokerage and intermediary services being services of facilitating the electronic transfer of funds between lenders and borrowers and between parties involved in financial transactionsfinancial investment informationadvice and brokerage servicesfinancial exchange servicesfinancial factoring servicesraising of financial capital for others; Insurance informationadvice and consultancy services; insurance brokerage servicesnamely arranging insurance for others; insurance underwriting services for all types of insurance.
Classe 38
Providing telecommunications connectionsvia an internet-based websiteplatformforum or portalto services being or relating to marketingadvertisingpromotionbusiness organisation and managementbusiness administrationbusiness assistancebusiness communicationsbusiness privacy and securityoffice functionshuman resourcesfinancial mattersaccountancybusiness planningbusiness informationbusiness advice and consultancymarket researchbusiness networkingpublic relationssocial mediaweb content managemente-commercesearch facilitieswebsite and web page designdevelopmenthosting and management; Providing telecommunications connectionsvia an internet-based websiteplatformforum or portalto computer softwaremobile device software and appsall for use in accessing or using or providing online or web-based services being or relating to marketingadvertisingpromotionbusiness organisation and managementbusiness administrationbusiness assistancebusiness communicationsbusiness privacy and securityoffice functionshuman resourcesfinancial mattersaccountancybusiness planningbusiness informationbusiness advice and consultancymarket researchbusiness networkingpublic relationssocial mediaweb content managemente-commercesearch facilitieswebsite and web page designdevelopmenthosting and management; Providing telecommunications connectionsvia an internet-based websiteplatformforum or portalto informationadviceconsultancyresources and content all for or relating to marketingadvertisingpromotionbusiness organisation and managementbusiness administrationbusiness assistancebusiness communicationsbusiness privacy and securityoffice functionshuman resourcesfinancial mattersaccountancybusiness planningbusiness informationbusiness advice and consultancymarket researchbusiness networkingpublic relationssocial mediaweb content managemente-commercesearch facilitieswebsite and web page designdevelopmenthosting and management; Providing web-based or online access to emailtext messagingshort messaging services (SMS)messagingchat messaging and conversationschat-roomselectronic bulletin boardsdiscussion forumssocial media forumschannels and online spacesall being via a web-based or online websiteplatformforum or portal; Electronic transmission of emailtext messages and short messages (SMS)electronic messaging servicesproviding internet or online chat-roomsproviding electronic bulletin boardsproviding internet or online discussion forums for transmissions of messages and chats between usersproviding internet or online forumschannels and spaces for social interaction and networking.
Classe 42
Software as a service (SaaS) services featuring software for website and web page designsales promotion and sales managementmarketing assistance and promotion and management and automationbusiness organisation and management operationscommunicationscontent managementreview and feedback management; Software as a service (SAAS) services featuring software for relationship managementinventory managementaccountingquoting of price or fee estimatesinvoicingpaymentsreporting of marketing and sales and business and financial dataanalytics in connection with marketing and sales and business and financial dataprivacy and security in relation to businesses and service providers; Software as a service (SaaS) services featuring software for e-commerce managementmanagement of online marketplacesprice comparisons; Software as a service (SaaS) services featuring software for use in accessing or using or providing online or web-based services being or relating to marketingadvertisingpromotionbusiness organisation and managementbusiness administrationbusiness assistancebusiness communicationsbusiness privacy and securityoffice functionshuman resourcesfinancial mattersaccountancybusiness planningbusiness informationbusiness advice and consultancymarket researchbusiness networkingpublic relationssocial mediaweb content managemente-commercesearch facilitieswebsite and web page designdevelopmenthosting and management; Hosting of computer softwaremobile device software and appsall for use in accessing or using or providing online or web-based services being or relating to marketingadvertisingpromotionbusiness organisation and managementbusiness administrationbusiness assistancebusiness communicationsbusiness privacy and securityoffice functionshuman resourcesfinancial mattersaccountancybusiness planningbusiness informationbusiness advice and consultancymarket researchbusiness networkingpublic relationssocial mediaweb content managemente-commercesearch facilitieswebsite and web page designdevelopmenthosting and management; Rental or leasing of softwareall for use in accessing or using or providing online or web-based services being or relating to marketingadvertisingpromotionbusiness organisation and managementbusiness administrationbusiness assistancebusiness communicationsbusiness privacy and securityoffice functionshuman resourcesfinancial mattersaccountancybusiness planningbusiness informationbusiness advice and consultancymarket researchbusiness networkingpublic relationssocial mediaweb content managemente-commercesearch facilitieswebsite and web page designdevelopmenthosting and management; Hosting of websites and web pages; Rental and leasing of web servers; Hosting of a website or online platformforum or portal for the provision of services being or relating to marketingadvertisingpromotionbusiness organisation and managementbusiness administrationbusiness assistancebusiness communicationsbusiness privacy and securityoffice functionshuman resourcesfinancial mattersaccountancybusiness planningbusiness informationbusiness advice and consultancymarket researchbusiness networkingpublic relationssocial mediaweb content managemente-commercesearch facilitieswebsite and web page designdevelopmenthosting and management; Hosting of a website or online platformforum or portal for the provision of informationadviceresources and content all forrelating toservices in the fields of marketingadvertisingpromotionbusiness organisation and managementbusiness administrationbusiness assistancebusiness communicationsbusiness privacy and securityoffice functionshuman resourcesfinancial mattersaccountancybusiness planningbusiness informationbusiness advice and consultancymarket researchbusiness networkingpublic relationssocial mediaweb content managementecommercesearch facilitieswebsite and web page designdevelopmenthosting and management; Hosting of a website or online platformforum or portal for provision of services of the nature of emailtextSMSmessagingchatchat-roomelectronic bulletin boarddiscussion forumssocial media and other online or web-based channels; Hosting of computer or electronic databases for others; Hosting of digital multimedia content of the nature of textdatagraphicsimagesaudiovideoother formats on the internet or on websites; Hosting of digital content in the form of on-line journalsblogs and vlogs on the internet or on websites; Hosting of podcastsvideocastsmobile applicationsdigital content and multimedia entertainment content on the internet or on websites; Managing websites and web pages for others; Mapping services; Provision of internet search engines; Electronic data storage; Design and development of computer systems and computer softwaremobile device software and apps; Customisation and tailoring of computer software and hardware systems and of computer softwaremobile device software and apps; Design and development of websites and web pages; Design and development of website landing pages; Designdevelopment and customisation of computer and mobile device user interfaces; Design and development of computer and electronic databases; Writing of computer software; Writing of software for websites and web pages; Computer software integration services; Computer systemnetwork and database integration services; Integration of computer systemsnetworksdatabases and software into those of third parties; Integration of computer software and applications into online or website-based systemsnetworks and software of third parties; Consultancy services in the fields of designdevelopmentintegrationconfigurationinstallationusetestingproblem-solvingsupport and maintenance of computer softwaremobile device softwareapps and computer systems; Technical supporttroubleshootingproblem-solving and real-time chat services relating to computer softwarecomputer applicationswebsitesweb pagesuse thereof; Computer servicesnamely providing digital certificates that authenticate the identity of websites and encrypt information sent to a server using secure sockets layer (SSL) technologyproviding user authentication services in electronic transactions and communications on a global computer network; Computer services for the protection and security of softwareprovision of temporary use of online non-downloadable software for data security and prevention or reduction of computersoftware and data-related security risks; Graphic design and product design services; Graphic design services for advertising and promotional materials; Website design consultancy; Business card design services; Logo design services in the nature of graphic design; Brand design services in the nature of graphic design.
Classe 45
Domain name registration advisory and consultancy services; Domain name registration services; Domain name registration servicesglobal computer system domain name searching services for the purpose of providing advice on domain name registration; Domain name registration servicesservices providing information concerning listings of domain names for sale by others for the purpose of providing advice on domain name registration; Domain name registration servicesproviding information indicating expired domain names; Information services concerning availability of domain names for the purpose of domain name registration; Registration and transfer of domain names for identification of users on a global computer network; Domain name registrar servicesregistering domain names for use on a global computer network; Providing global computer system domain name searching services for the purpose of providing information and advice regarding domain name registration; Domain name registrar servicesregistering previously registered domain names by registering the domain names when the domain names become publicly available; Leasing of internet domain names; Domain name privacy services for enabling personal and business information and data relating to domain name registrations to be hidden from public view; Domain name reservation servicesservices of reserving domain names in advance for the purpose of purchasing and registering them in the future; Domain name registrar servicesproviding or allocating internet domains and domain names; Domain name registrar servicesmanaging domain names for others; Online social networking services; Legal services; Legal services relating to licences; Legal document preparation services; Legal research; Providing legal information about the availability of domain names; Providing legal information in relation to advertising and marketing; Alternative dispute resolution services; Arbitration services; Mediation services; Copyright management; Intellectual property watching services; Monitoring intellectual property rights for legal advisory purposes; Intellectual property consultancy; Legal services in the nature of licensing of computer software; Licensing of intellectual property; Litigation services; Licensing authority serviceslegal grantingissuingadministration and management of licences; Legal serviceslicensing of computer software.