Classe 3
After-shave; antiperspirants; aromatherapy preparationsessential oils for aromatherapy usenon-medicated aromatic bath preparationsaromatherapy cosmetic creamsaromatherapy skin lotionsaromatherapy underarm deodorantsaromatherapy perfumesaromatherapy lip balms; aromaticsaromatic oilspotpourrisattarsincense sticks; baby wipes impregnated with cosmetic lotions; bath salts; beauty masks; bubble bath; breath freshening sprays; essential oils for cake flavourings; cleansing milk for toilet purposes; cosmetic creams; cosmetic kits composed of lip glosseye shadowseyelinersmascaraslipstickslip linerslip stainspowderblushcleanserspalettes; cosmetic preparations for baths; cosmetics for animals; cosmetics; cotton sticks for cosmetic purposes; cotton wool for cosmetic purposes; decorative transfers for cosmetic purposes; dentifrices; deodorants for personal use; detergents for household use; eau de Cologne; essential oils; eyebrow cosmetics; eyebrow pencils; face glitter; false eyelashes; false nails; fingernail embellishments; hair color; hair conditioner and hair moistening preparations; hair cream; hair dyes; hair gel; hair lotions; hair spray; hair waving preparations; incense; lip balms; lipsticks; lotions for cosmetic purposes; make-up powder; make-up preparations; make-up removing preparations; make-up; mascara; moisturizing preparations for the skin; mouth washesnot for medical purposes; nail care preparations; nail polishes and varnishes and thinners therefor; non-medicated bath preparations; perfumery; perfumes; pomades for cosmetic purposes; potpourris; products and preparations for the care and cleansing of hair and skinhair colorshair conditionershair gelshair piece bonding glueshair moussesnon-medicated hair serumshair sprayshair tonicshair waxeshair volumizerspomadesskin cleansing gelsmoisturizing creamsrevitalizing hair tonics; spray on air fragrancing preparations; shaving preparations; shampoos for pets; shampoos; skin and face creams and lotions; skin moisturizer; soaps; sun block; sun-tanning preparations; temporary tattoo sprays and stencils therefor sold as a unit; tissues impregnated with cosmetic lotions; toilet water; non-medicated toiletries
Classe 5
Absorbent cotton for medical purposes; absorbent wadding for dressing; adhesive bands for medical purposes; adhesive plaster for medical purposes; adhesive tapes for medical purposes; dietetic albuminous foodstuffsnamely eggs and milkadapted for medical purposes; antiparasitic collars for animals; antiseptics; antiseptic cotton; balms for medical purposes; bath preparationsmedicated; bath salts for medical purposes; bandages for dressings; belts for sanitary napkins; capsules sold empty for medicines; capsules sold empty for pharmaceutical purposes; chewing gum for medical purposes; cotton for medical purposes; court plaster; cotton wool in the form of sticks for medical purposes; baby diapers made of cellulose; baby diapers made of paper; dietary food supplements; dietary and nutritional supplements; dietetic beverages adapted for medical purposesnutritionally fortified beverages; dietetic foodspastachocolate and crackers adapted for medical purposes; dietetic foods adapted for infants; dietetic supplements adapted for medical use; disinfectants; all purpose disinfectants for hygiene purposes; medicated grooming preparation for dogsnamely lotions and washes; medicines for dental purposescardiovascular disordersdental purposes; eye-wash; first-aid kits; fly catching adhesives; fly catching paper; fly destroying preparations; fly glue; fungicides; herbicides; germicides; herb teas for medical purposes; hygienic bandages for skin wounds; insect repellents; insecticides; lotions for pharmaceutical purposes; lotions for veterinary purposes; lozenges for pharmaceutical purposes; material for stopping teeth; dental wax; medical preparations for slimming purposes; medicinal alcohol; medicinal drinks; medicinal herbs; medicinal oils; medicinal tea; portable medicine cases sold filled with bandages for dressing antiseptic wipesacetaminophen; medicated confectionery; menthol for pharmaceutical purposes; mineral supplements in tabletpowder or capsule form; mothproofing paper; mothproofing preparations; medicated mouthwashes for medical purposes; mud for therapeutic baths; napkins for incontinence; antibiotic ointments; oxygen baths for medical purposes; absorbent diapers for incontinence; poultices; medicated compresses; protein dietary supplements; antiperspirants for foot perspiration; repellents for dogs; royal jelly dietary supplements; salts for mineral water baths for medical purposes; sanitary napkins; sanitary panties; sanitary towels; smelling salts; medicated sunburn ointments; sunburn preparations for pharmaceutical purposes; syrups for the treatment of coldsfeverscoughssore throats; sterilising preparations; therapeutic medicated preparations for the bath; tissues impregnated with pharmaceutical lotions; vitamin preparations in the nature of food supplements
Classe 9
Application development tool computer programs for personal computersmobile digital electronic deviceshand held computersmobile telephones; carrying cases for cell phonestelephonespagers and mobile computers; computer game software and entertainment software in the nature of computer games for use on mobile and cellular phoneshandheld computerscomputersvideo game consolesboth handheld and free standingother wireless point of sale devices; computer game software featuring character recognitionvoice recognitiontouch sensitivitylight sensitivitygravity sensitivity; computer game software for electronic computer apparatus featuring interactive and multimedia functions that enable the user to integrate textaudiographicsstill images and moving pictures; computer game software; decorative magnets; digital mediaCDsDVDsmemory cardsdownloadable audiovideomultimedia filesfeaturing musicmotion picture and animated cartoon characters; digital memory devicesblank CDs and DVDsaudio/video discs featuring video gamesblank minidiscsUSB flash drivesblank flash memory cards; downloadable computer game software for playing videocomputer and on-line games; downloadable ring tonesmusicvideoselectronic gamesvia the internet and wireless devices; downloadable software for developingdesigningmodifyingrecording and customizing sound and speech; downloadable software for developingdesigningmodifyingrecording and customizing videocomputer and on-line games; downloadable video game software featuring touch and voice control; eyewear cases; eyewear; interactive multimedia computer game software programs; mouse pads; software for enabling video computer and on-line games to be run on multiple platforms; speech recognition software; touch and voice driven interactive video game software; loudspeakers; handheld computers; mobile phones
Classe 11
Air purifiers; barbecues; bed warmers; beverages cooling apparatus; bicycle lights; bicycle reflectors; chandeliers; disinfectant dispensers for toilets; dispensing units for air fresheners; electric blanketsnot for medical purposes; electric fans; electric kettles; electric lamps; electric lights for Christmas trees; electric popcorn poppers; electric toasters; electric vaporizers for household purposes; flashlights; globes for lamps; hair dryers; ice boxes; lamp casings; lamp mantles; lamp reflectors; lamp shades; lamps; lampshade holders; lanterns for lighting; non-electric pocket warmerschemically-activated heating packets for warming hands; ornamental fountains; outdoor portable lighting productsheadlamps; pen lights; reading lights; toilet seats; water purifying apparatus; water sterilizers
Classe 14
Bracelets; buckles for watchstraps; clocks; horological and chronometric instruments and parts thereof; imitation jewelry; jewelry chains; jewelry; key chains as jewelry; lapel pins; ornaments of precious metal in the nature of jewelry; pendants; watches; necklaces; non-metal and non-leather key chains; non-metal key rings
Classe 16
Ball pens; bibs of paper; bookmarks; books in the field of cartoon characters; boxes of cardboard or paper; calendars; chalks; children's books; color pencil sets; color pencilscrayons; coloring books; comic books; drawing instruments; drawing paper; drawing rulers; erasing productscorrecting tapesrubber eraserseraserserasing fluidsink erasers; fountain pens; gift boxes; glue for stationery or household purposes; greeting cards; loose-leaf binders; lunch bags of paper; musical greeting cards; note books; packing paperwrapping paper and packaging materials made of paper; writing pads; paintings; paper napkins; paper staplers; party ornaments of paper; paste for stationery or household purposes; pen and pencil cases and boxes; pencil sharpeners; pencils; pens; photograph albums; place mats and coasters of paper or cardboard; posters; printed publicationsnewspapers and magazines in the fields of video gamesanimated charactersonline entertainment; rubber stamps; stationery; stickers; table cloths of paper; table linen of paper; writing instruments; writing padsmemo padswriting paper; wallpaper stencils
Classe 18
All-purpose carrying bags; animal leashes; backpacks; bags for sports; book bags; briefcases; carrying cases; collars for pets; duffel bags; handbags; key cases; leather or leather-board boxes; luggage tags; luggage; messenger bags; pouches of leather; pouches of textile; purses; school satchels; sling bags for carrying infants; suitcases; toiletry bags sold empty; toiletry cases sold empty; tote bags; travelling bags; umbrellas; wallets
Classe 20
Bamboo blinds; boxes of wood or plastic; corks; curtain hooks; curtain rails; curtain rings; curtain rods; curtain tie-backs in the nature of non-textile curtain holders; figurines and statuettes made of plasterplasticwax and wood; fireplace screens for domestic use; mirrors; non-metal basketsbaskets for transporting goods for commercial purposesfishing baskets for industrial purposesnon-metal bed fittings; non-metal clothes hooks; photograph frames; picture frames; pillows; sleeping bags; statues of woodwaxplaster and plastic; toy boxes; wind chimes; works of art and ornaments made of plasterplasticwax and wood
Classe 21
Baby bathtubs; basins; baskets for domestic usenot of metal; bath brushes; bath productsbody sponges; beverage glassware; thermal insulated containers for beverages; bird cages; bottlessold empty; bowls; buckets; cages for household pets; cake molds; candlesticks; candy boxes; canteens; cleaning cloths; coastersnot of paper and other than table linen; cocktail shakers; combs; cookie jars; corkscrews; crockerypotsdishesdrinking cups and saucersbowlsserving bowls and trays; cups; cutting boards; dental floss; drinking flasks; dust bins; egg cups; fly swatters; foam drink holders; fragrances oil burners; gloves for household purposes; grooming tools for petscombs and brushes; hairbrushes; heat-insulated vessels; ice buckets; ice cube molds; ironing board covers; jugs; non-electric kettles; lunch boxes; mixing bowls; mixing spoons; mugs; napkin holders; non-electric food blenders for household purposes; non-metal piggy banks; ornaments of ceramicschinaglasscrystalearthenwareterra-cottaporcelain; paper plates; pastry cutters; fitted picnic baskets sold empty; pitchers; portable coolers; soap boxes; soap dispensers; soap holders; sponges for household purposes; statues of porcelainterra-cotta or glass; stoppers specially adapted for bottles of ceramicschinaglasscrystalearthenwareterra-cotta and porcelainsold empty; tea pots; toilet brushes; toilet roll holders; toothbrushes; toothpick holders; toothpicks; trash cans; trays for domestic purposes; troughs; vacuum bottles; vases; waste baskets; watering cans; works of art of porcelainterra-cotta or glass; picnic baskets sold empty
Classe 24
Banners and flags of textile; bath linen; bed linen; bedspreads; bed blankets; clothstable cloth of textilecotton clothwoolen clothsilk clothlinen clothgauze fabric; cotton fabrics; covers for cushions; curtain tie-backs in the nature of textile curtain holders; curtains; fabrics for textile use; unfitted furniture coverings of textile; handkerchiefs of textile; mattress covers; pillowcases; quilts; textile place mats; textile tablecloths; towels; wall hangings of textile
Classe 25
Articles of clothingswimwearswimsuitssportswearsports jerseyswaterproof jackets and pantsrain wearglovesmittensbeltsunderwearsleep wearpajamasbathrobeshatscapssun visorsberetssocksstockingspanty hoseshoessports shoesslipperssneakersbeach shoesmasquerade costumesbandanasjacketsknitwearknitted jerseys and t-shirts and shirts; outerwearoutdoor winter clothing namelywinter boots and jackets and coats and ski pants and cardigans and anoraks and wind resistant jacketsrain coatssoft-shell jacketsshortsdressesskirtscoatsvestssweaterstiesscarvessweatshirtshooded sweatshirtsgowns; bibsnot of paper; children's and infant's apparelsports jumpersone-piece garmentst-shirtsarm and leg warmerstrouserscoatsjacketscostumesgloves and mittenshatsromperssleepwearsockshooded sweatshirts; footwear; headwear; wrist bands
Classe 27
Bath mats; carpets and rugs; door mats; floor coverings; foam mats for use on play area surfaces; linoleum; non-textile wall hangings; wallpaper
Classe 28
Action figure toys; arcade games; arcade-type electronic video games; articles of clothing for toys; balloons; bath toys; battery operated action toys; board games; sleds; bubble making wand and solution sets; card games; Christmas tree ornaments and decorations; dolls designed to resemble computer game characters; dolls responding to signals from other electronic devices; plush toys designed to resemble computer game characters; plastic character toys designed to resemble computer game characters; plush toys responding to signals from other electronic devices; electronic novelty toystoys that electronically recordplay backdistort or manipulate voices and sounds; gambling machines; game controllers for computer games; ice skates; infant toys; inflatable toys; in-line roller skates; interactive hand-held audio-visual games with displays not for use with television receivers; kite reels; kites; mechanical toys; musical toys; parlor games; party favors in the nature of small toys; party games; pinball games; plastic character toys; plush toys; puppets; rubber character toys; sandbox toys; action skill games; squeeze toys; stand-alone video output game machines; swings; tabletop games; talking dolls; talking toys; toy masks; toy snow globes; toy vehicles; water toys; wind-up toys; stand-alone video game machines for use with external display screens or monitors; building blocks toys; body boards; chess games; apparatus for gamesbassesbates and balls for playing indoor and outdoor games; electronic toys; electronic learning toys; battery operated toys; puzzles; plastic character toys; electronic remote controlled toyscarsrace carsairplanes and boats
Classe 29
Bacon; bouillon; bouillon concentrates; broth; broth concentrates; butter; caviar; cheesechocolate nut butter; charcuterie; meat croquettes; crystallized fruits; drinks made from dairy products; edible oils and fats; eggs; fruit peel; fishtinned; fruitstinned; food products made from fishfishcakesfish croquetteschow mienfish soup; frosted fruits; frozen fruits; fruit chips; jelliesjamscompotesfruit and vegetable spreads; maize oil; margarine; marmalade; meat jellies; meat tinned; meat extracts; milk beverages with high milk content; olive oil for food; preserved mushrooms; preserved fruits; preserved vegetables; prepared nuts; pates; peanut butter; peanutsprocessed; peaspreserved; potato chips; potato fritters; preparations for making bouillon; preparations for making soup; raisins; soups; processededible seaweeds; yoghurt; processed seafood; salads; sauerkraut; sausages; sesame oil; seafoodtinned; tofu; tomato purée; vegetable salads; vegetable soup preparation; vegetablestinned; whipped cream
Classe 30
Almond confectionery; aromatic flavourings for food; starch-based binding agents for ice cream edible ices; biscuits; bread rolls; buns; cakes; cake flour; caramels candy; cereal based snack food; cereal flakes; coffee; cheese curls snacks; chewing gums; chocolate; chocolate bars; preparation for making beverages chocolate based; chocolate beverages with milk; chocolate coated nuts; chocolate confectionery; chocolate decorations; chocolate flavored coatings; chocolate for decorating Christmas trees; confectionery made of sugar; chocolate truffles; cocoa; cocoa-based beverages; cocoa beverages with milk; cocoa powder; cocoacocoa based beverages and cocoa preparationsmixespowder and spreads; coffee-based beverages; coffee beverages; coffee flavourings; confectionery for decorating Christmas trees; confectionery ices; cookies; cooking salt; corn flakes; corn meal; crackers; curry spices; custard; edible ices; edible decorations for cakes; frozen yoghurt; fruit jelly candy; fruit sauces excluding cranberry sauce and applesauce; flavourings for cakesother than essential oils; gingerbread; honey; herbal teas and herbal infusions; herbal preparationssalthoney infusions and processed herbs; ice cream; ice cream drinks; baking-powder; ketchup; liquorice; macaroni; marzipan; marzipan substitutes; mayonnaise; meat gravies; meat pies; meat tenderizersfor household purposes; oatmeal; pastry; popcorn; pancakes; pasta; pepper; peppers powder and spices; pizzas; pretzels; puddings; puddings in powder form; ravioli; relishes; rice based snack food; rice cakes; rusks; salad dressings; sandwiches; sherbets ices; rice-basedcereal based and wheat-based snack foods; topping syrup; spaghetti; spices; soy sauce; chocolate based spreads; sweetmeats candy; sushi; sugar; tarts; tea based beverages; teas; tomato sauce; udon noodles; vinegar; condimentsoyster saucepepper sauceketchupsalsamustard; wasabi paste; wheat flour; vanilla; waffles
Classe 32
Aerated water; aperitifsnon-alcoholic; beers; cidernon-alcoholic; non-alcoholic cocktails; energy drinks; essences for making non-alcoholic beverages; fruit drinks and fruit juices; fruit nectarsnon-alcoholic; lemonades; milk of almonds for beverage; mineral water; non-alcoholic drinks and beveragescarbonated beveragesfruit juice beveragesmalt beverages; non-alcoholic fruit juice beverages; pastilles for effervescing beverages; powders for effervescing beverages; smoothies; soda water; soft drinks; sorbets in the form of beverages; syrups for making beverages; fruit juice concentrates; table waters; vegetable drinks and vegetable juices; waters beverages; whey beverages
Classe 35
Wholesaling and retailing store services relating to the sale of party favoursplastic and paper jewelryplastic toyspaper hatspaper and plastic whistles and magic setsfestive decorations and ornamentsproducts for decorating roomsclothingjewelry and papersoapsperfumeryessential oilscosmeticshair lotionshair care productstoiletriesdentifricespersonal hygiene productscleaningpolishing and abrasive preparationssubstances for laundry usemanicure toolsnail care preparationsnail polishfalse nailsdietetic substancesfood for babiessanitary preparationscandleswicksspills for lightinggreaseslubricantsoils for paintscutlerycrockerymanicure setsshaving instrumentsrazorsmachines and machine tools for kitchen or household purposesdishwasherswashing machinescooker hoodskitchen stoves and mixershand-held toolsfilmscamerasphoto discsvideo recordersaudio and visual productsaudio and video tapesrecords and discsinstruments and apparatus for the recordingtransmitting and/or reproduction of sounds and/or imagestelevisionscassette tape players and/or recordersvideo cassette and/or disc players and/or recordersradiostelephoneswireless phonesmobile phonesmobile phone casesdecorations and straps for phonescall indicatorscalculating machinescalculatorselectronic and computer gamescinematographic filmslightsfanscooking utensilscake and pastry mouldstoastersovenskitchen utensilsjuice squeezersblenderscuttersscalespansdishescutleryplatescupsglasses and bowlsutensils and containers for serving or storing food and/or beverageschop stickscutting instrumentsporcelainchinawarecrystalwareenamelwaresilverwareglasswareterra-cottawareearthenwareceramicshair dryerslampslamp shades and parts and fittings thereforbaby carriagesballoonsbicycle hornsclocks and watches and accessories and parts and fittings thereforjewellery and imitation jewelleryornamentsgoods in precious metal or coated therewithjewelrywatchesclockssculptures and boxesmusic boxesmusical instrumentspicturesphotographsstationerypaper and cardboard and goods made from these materialscontainersboxesbagsposterstowels and handkerchiefsartists materialspaint brusheswriting instrumentsprinted matterbooksnewspapersmagazines and periodicalsgreeting and Christmas cardsplaying cardspacking and packaging materialspicture frames and standsadhesives for stationery or household purposesgoods made of leather and/or imitations of leatherbagswalletsclothesshoesriding equipment and furniturebags and luggagepurses and walletsumbrellaswalking sticksfurnituremirrorscoat hangers and pegsboxes and containersname platescontainerscombsspongesbrushesarticles for cleaning purposesspectaclesspectacle frames and sunglasses and cases and accessories therefortextile and textile goodsbeddingtable linens and coversnapkinsmatsfurniturehaberdasheryhandkerchiefsarticles of clothingfootwear and headgearproducts from clothingfootwear and headgearswimwearjackets and waterproof jacketsrain wearbeltsunderwearnightwearhatscapssun visorssocksstockingstightsmasquerade costumesjacketsknitwearshirtsmen's shirtouterwearshortsdressesskirtscoatsvestssweaterstiesscarvessweatshirtsrobesbibsclothing for children and infantsshoessports sneakersslippersshoes for the beachcovers and cuffs and buttonsbadgesribbons and braidlace and embroideryhair pins and ornamentsbracesshoe ornamentshat ornamentszipper and zipper fastenerscarpetsrugs and matstoysgames and playthingsdollsfigurinesdecorations for Christmas treesfood and beveragesconfectioneryfloral productsmatchescigarscigarettes and smokers' articles; business management of performing artists; import-export agencies; compilation of information into computer databases; direct mail advertising; business management of hotels; procurement services for otherspurchasing clothingfashion accessoriesoffice suppliesfurniturehousehold goods for others; office machines and equipment rental; rental of vending machines
Classe 38
Providing telecommunications connections to a global computer network; cable television broadcasting; cellular telephone communication; communications by fiber optic networks; communications by telegrams; communications by telephone; computer aided transmission of messages and images; electronic mail; facsimile transmission; radio broadcasting; sending of telegrams; telegraph services; locallong-distancecellular telephone services; television broadcasting; wire servicestransmission of messages by wire; paging services; providing telecommunications connections to a global computer network; providing user access to a global computer network; telecommunications routing and junction services; electronic bulletin board services; teleconferencing services; music broadcasting; terrestrialcable or satellite broadcasting of radiotelevisionteletext or of data; computer aided transmission of messagesdata and images; communications by computer terminals; news agency servicesthe transmission of news items to news reporting organizations; information and advisory services in the field of telecommunications; broadcasting and transmission of programsfilmsimagesmusicgamesexcerpts and text via all forms of technology to television setspersonal computers and recorderswireless receptorstelephones and mobile phonespublic screens and any other device or facility capable of receiving such content; communication by consumer video game apparatus; providing information on communication by consumer video game apparatus; communication by arcade video game machines; providing information on communication by arcade video game machines; communication by handheld game apparatus; providing information on communication by handheld game apparatus; message sending
Classe 41
Amusement park and theme park services; entertainment in the nature of competitions in the field of computer and video games; entertainment in the nature of live stage performances featuring animated characters; entertainment in the nature of theater productions; entertainment servicesproviding online computer games and online video games that are accessible and playable via mobile and cellular phones and other wireless devices; entertainment serviceslivetelevised and movie appearances by a professional entertainer; entertainment servicesproviding information in the field of musicvideo gamesanimated cartoon characters via a web site; entertainment servicesproviding on-line computer games; entertainment servicesproviding touch and voice driven online computer games for digital mobile devices; multimedia publishing of booksmagazinesjournalssoftwaregamesmusicelectronic publications; on-line gaming servicesproviding on-line computer games; arranging or organizing of online multiplayer video game tournaments; providing non-downloadable audio and video files in the field of entertainment relating to interactive computer game softwareinteractive video game software and interactive computer and video games; game services provided online from a mobile phone networkproviding on-line computer games; providing news and information in the field of entertainment regarding interactive computer game softwareinteractive video game software and interactive computer and video gamesvia electronicwireless and computer networks; providing non-downloadable video and audio recordings about animated cartoon characters made within computer games via a website; providing online computer and video games accessed and played via electronicwireless and computer networks; rental of sound recordings
Classe 42
Computer graphics design servicescreation of computer generated cartoon animated images; computer hardware and software consulting services; computer programming; computer software consulting; computer systems analysis; conversion of data from physical to electronic media; design of computer systems; developmentconsultancy on and designing of computer software; developmentconsultancy on and designing of touch and voice driven computer software for electronic digital mobile devices; engineering in the field of computer science; hosting a web site featuring user generated content; providing a website featuring technology that allows users to download computer software from a global computer network; configuringmaintenance and servicing of computer software; updating and maintenance of computer softwareincluding touch and voice driven computer software for electronic digital mobile devices