Classe 3
After-shave; antiperspirants; aromatherapy preparationsessential oils for aromatherapy usenon-medicated aromatic bath preparationsaromatherapy cosmetic creamsaromatherapy skin lotionsaromatherapy underarm deodorantsaromatherapy perfumesaromatherapy lip balms; aromaticsaromatic oilspotpourrisattarsincense sticks; baby wipes impregnated with cosmetic lotions; bath salts; beauty masks; bubble bath; breath freshening sprays; flavourings for cakes other than essential oils; cleansing milk for toilet purposes; cosmetic creams; cosmetic kits composed of lip glosseye shadowseyelinersmascaraslipstickslip linerslip stainspowderblushcleanserspalettes; cosmetic preparations for baths; cosmetics for animals; cosmetics; cotton sticks for cosmetic purposes; cotton wool for cosmetic purposes; decorative transfers for cosmetic purposes; dentifrices; deodorants for personal use; detergents for household use; eau de Cologne; essential oils; eyebrow cosmetics; eyebrow pencils; face glitter; false eyelashes; false nails; fingernail embellishments; hair color; hair conditioner and hair moistening preparations; hair cream; hair dyes; hair gel; hair lotions; hair spray; hair waving preparations; incense; lip balms; lipsticks; lotions for cosmetic purposes; make-up powder; make-up preparations; make-up removing preparations; make-up; mascara; moisturizing preparations for the skin; mouth washesnot for medical purposes; nail care preparations; nail polishes and varnishes and thinners therefor; non-medicated bath preparations; perfumery; perfumes; pomades for cosmetic purposes; potpourris; products and preparations for the care and cleansing of hair and skinhair colorshair conditionershair gelshair glueshair mousseshair serumshair sprayshair tonicshair waxeshair volumizerspomadesskin cleansing gelsmoisturizing creamsrevitalizing tonics; spray on air fragrancing preparations; shaving preparations; shampoos for pets; shampoos; skin and face creams and lotions; skin moisturizer; soaps; sun block; sun-tanning preparations; temporary tattoo sprays and stencils therefor sold as a unit for cosmetic purposes; tissues impregnated with cosmetic lotions; toilet water; non-medicated toiletries
Classe 5
Absorbent cotton for medical purposes; absorbent wadding for dressings; adhesive bands for medical purposes; adhesive plaster for medical purposes; adhesive tapes for medical purposes; medicated supplements for foodstuffs for babiesalbuminous foodstuffs for medical purposes; antiparasitic collars for animals; antiseptics; antiseptic cotton; balms for medical purposes; bath preparationsmedicated; bath salts for medical purposes; bandages for dressings; belts for sanitary napkins towels; capsules for medicinesgelatin capsules sold empty; capsules for pharmaceutical purposescapsules sold empty for pharmaceuticals; chewing gum for medical purposes; cotton for medical purposes; court plaster; cotton wool in the form of sticks for medical purposes; diapers made of cellulose; diapers made of paper; dietary food supplements; dietary and nutritional supplements; dietetic beverages adapted for medical purposes; dietetic foodspastacrackerscerealschocolate adapted for medical purposes; dietetic foodspastacrackerscerealschocolate adapted for infants; dietetic substancessugarsugar substitutes adapted for medical use; disinfectants for medical instruments; disinfectants for hygiene purposes; dog lotionsmedicated lotions for treating dermatological conditions; dog washessaline wash for medical purposes; drugs for medical purposes for the treatment of stressfatiguemusculoskeletal disordershigh blood pressurehigh cholesterolhigh blood sugarmuscle painjoint pain and arthritis; eye-wash; first-aid boxes filled; fly catching adhesives; fly catching paper; fly destroying preparations; fly glue; fungicides; herbicides; germicides; herb teas for medical purposes; bandages for skin wounds; insect repellents; insecticides; lotions for pharmaceutical purposes; lotions for veterinary purposes; medicated lozenges for pharmaceutical purposes; material for stopping teethamalgamsartificial resinscementporcelainfiberglass and zirconium; dental wax; medical preparations for slimming purposes; medicinal alcohol; medicinal drinks; medicinal herbs; medicinal oils; medicinal tea; medicine cases portable filledcontainers for veterinary and human medical and clinical use sold filled with a platelet additive solution; medicated confectionery; menthol for pharmaceutical purposes; mineral supplements in tabletpowder or capsule form; mothproofing paper; mothproofing preparations; mouthwashes for medical purposes; mud for bathsmedicated bath preparations; napkins for incontinence; antibiotic ointments; oxygen baths for medical use; incontinence garmentspants; poultices; medicated compresses; protein dietary supplements; remedies for foot perspirationmedicated foot powder; repellents for dogs; royal jelly dietary supplements; salts for mineral water bathsbath salts for medical use; sanitary napkins; sanitary panties; sanitary towels; smelling salts; medicated sunburn ointments; sunburn preparations for pharmaceutical purposes; syrups for pharmaceutical purposes for the treatment of coughallergiescoldintestines; sterilising preparations; therapeutic medicated bath preparations; tissues impregnated with pharmaceutical lotions; vitamin preparations in the nature of food supplements
Classe 9
Application development tool programs for personal computersmobile digital electronic deviceshand held computersmobile telephones; carrying cases for cell phonestelephonespagers and mobile computers; computer game software and entertainment software in the nature of computer games for use on mobile and cellular phoneshandheld computerscomputersvideo game consolesboth handheld and free standingother wireless point of sale devices; computer game software featuring character recognitionvoice recognitiontouch sensitivitylight sensitivitygravity sensitivity; computer game software for electronic computer apparatus featuring interactive and multimedia functions that enable the user to integrate textaudiographicsstill images and moving pictures; computer game software; decorative magnets; digital mediaCDsDVDsmemory cardsdownloadable audiovideomultimedia filesfeaturing musicmotion picture and animated cartoon characters; digital memory devicesblank CDs and DVDsaudio and video discsaudio and video minidiscsUSB flash drivesflash memory cards; downloadable computer game software for playing videocomputer and on-line games ; downloadable ring tonesmusicvideoselectronic gamesvia the internet and wireless devices; downloadable software for developingdesigningmodifyingrecording and customizing sound and speech; downloadable software for developingdesigningmodifyingrecording and customizing videocomputer and on-line games; downloadable video game software featuring touch and voice control; earphones; eyewear cases; eyewear; headphones; interactive multimedia computer game software programs; mouse pads; software for enabling video computer and on-line games to be run on multiple platforms; speech recognition software; touch and voice driven interactive video game software; virtual reality headsets and helmets for use in playing video games; walkie-talkies; loudspeakers; handheld computers; mobile phones; microphones
Classe 11
Air purifiers; barbecues; bed warmers; beverages cooling apparatus; bicycle lights; bicycle reflectors; chandeliers; disinfectant dispensers for toilets; dispensing units for air fresheners; electric blanketsnot for medical purposes; electric fans; electric kettles; electric lamps; electric lights for Christmas trees; electric popcorn poppers; electric toasters; electric vaporizers for household purposes; flashlights; globes for lamps; hair dryers; ice boxes; lamp casings; lamp mantles; lamp reflectors; lamp shades; lamps; lampshade holders; lanterns for lightning; non-electric pocket warmerschemically-activated heating packets for non-electric pocket warmerschemically-activated heating packets for warming hands; ornamental fountains; outdoor portable lighting productsheadlamps; pen lights; reading lights; toilet seats; water purifying apparatus; water sterilizers
Classe 14
Bracelets; buckles for watchstraps; clocks; horological and chronometric instruments and parts thereof; imitation jewelry; jewelry chains; jewelry; key chains as jewelry; lapel pins; ornaments of precious metal in the nature of jewelry; pendants; watches; necklaces; non-metal and non-leather key chains; non-metal key rings
Classe 16
Ball pens; bibs of paper; bookmarks; books in the field of cartoon characters; boxes of cardboard or paper; calendars; chalks; children's books; color pencil sets; color pencilscrayons; coloring books; comic books; drawing instruments; drawing paper; drawing rulers; erasing productscorrecting tapesrubber eraserseraserserasing fluidsink erasers; fountain pens; gift boxes; glue for stationery or household purposes; greeting cards; loose-leaf binders; lunch bags of paper; musical greeting cards; note books; packing paperwrapping paper and packaging materials made of paper; writing pads; paintings; paper napkins; paper staplers; party ornaments of paper; paste for stationery or household purposes; pen and pencil cases and boxes; pencil sharpeners; pencils; pens; photograph albums; place mats and coasters of paper or cardboard; posters; printed publicationsnewspapers and magazines in the fields of video gamesanimated charactersonline entertainment; rubber stamps; stationery; stickers ; table cloths of paper; table linen of paper; writing instruments; writing padsmemo padswriting paper; wallpaper stencils
Classe 18
All-purpose carrying bags; animal leashes; backpacks; bags for sports; book bags; briefcases; carrying cases; collars for pets; duffel bags; handbags; key cases; leather or leather-board boxes; luggage tags luggage; messenger bags; pouches of leather; pouches of textile; purses; school satchels; sling bags for carrying infants; suitcases; toiletry bags sold empty; toiletry cases sold empty; tote bags ; travelling bags ; umbrellas; wallets
Classe 20
Bamboo blinds; beds; book shelves; boxes of wood or plastic; chairs; corks; cradles; cupboards; curtain hooks; curtain rails; curtain rings; curtain rods; curtain tie-backs in the nature of non-textile curtain holders; cushions; desks; dressing tables; easy chairs; figurines and statuettes made of plasterplasticwax and wood; fire screens for domestic use; furniture; garment coversgarment covers for storagewardrobes; high chairs for babies; mirrors; non-metal basketsbaskets for transporting goods for commercial purposesfishing baskets; non-metal bed fittings; non-metal clothes hooks; photograph frames; picture frames; pillows; playpens for babies; sleeping bags; statues of woodwaxplaster and plastic; toy boxes; wind chimes; works of art and ornaments made of plasterplasticwax and wood
Classe 21
Baby bathtubs; basins; baskets for domestic usenot of metal; bath brushes; bath productsbody sponges; beverage glassware; containers for beverages; bird cages; bottlessold empty; bowls; buckets; cages for household pets; cake molds; candlesticks; candy boxes; canteens; cleaning cloths; coastersnot of paper and other than table linen; cocktail shakers; combs; cookie jars; corkscrews; crockerypotsdishesdrinking cups and saucersbowlsserving bowls and trays; cups; cutting boards; dental floss; drinking flasks; dust bins; egg cups; fly swatters; foam drink holders; fragrances oil burners; gloves for household purposes; grooming tools for petscombs and brushes; hairbrushes; heat-insulated vessels; ice buckets; ice cube molds; ironing board covers; jugs; non-electric kettles; lunch boxes; mixing bowls; mixing spoons; mugs; napkin holders; non-electric food blenders for household purposes; non-metal piggy banks; ornaments of ceramicschinaglasscrystalearthenwareterra-cottaporcelain; paper plates; pastry cutters; fitted picnic baskets sold empty; pitchers; portable coolers; soap boxes; soap dispensers; soap holders; sponges for household purposes; statues of porcelainterra-cotta or glass; stoppers for bottles of ceramicschinaglasscrystalearthenwareterra-cotta and porcelain; tea pots; toilet brushes; toilet roll holders; toothbrushes; toothpick holders; toothpicks; trash cans; trays for domestic purposes; troughs; vacuum bottles; vases; waste baskets; watering cans; works of art of porcelainterra-cotta or glass; picnic baskets sold empty
Classe 24
Banners and flags of textile; bath linen; bed linen; bedspreads; bed blankets; clothstable cloth of textilecotton clothwoolen clothsilk clothlinen clothgauze cloth; cotton fabrics; covers for cushions; curtain tie-backs in the nature of textile curtain holders; curtains; fabrics for textile use; unfitted furniture coverings of textile; handkerchiefs of textile; mattress covers; pillowcases; quilts; textile place mats; textile tablecloths; towels; wall hangings of textile
Classe 25
Articles of clothingswimwearswimsuitssportswearsports jerseyswaterproof jackets and pantsrain wearglovesmittensbeltsunderwearsleep wearpajamasbathrobeshatscapssun visorsberetssocksstockingspanty hoseshoessports shoesslipperssneakersbeach shoesmasquerade costumesbandanasjacketsknitwearknitted jerseys and t-shirts and shirts; outerwearoutdoor winter clothingwinter boots and jackets and coats and ski pants and cardigans and anoraks and wind resistant jacketsrain coatssoft-shell jacketsshortsdressesskirtscoatsvestssweaterstiesscarvessweatshirtshooded sweatshirtsgowns; bibsnot of paper; children's and infant's apparelsports jumpersone-piece garmentst-shirtsarm and leg warmerstrouserscoatsjacketscostumes for use in children's dress up playdance costumes and bathing costumesgloves and mittenshatsromperssleepwearsockshooded sweatshirts; footwear; headwear; wrist bands
Classe 27
Bath mats; carpets and rugs; door mats; floor coverings; foam mats for use on play area surfaces; linoleum; wall hangingsnot of textile; wallpaper
Classe 28
Action figure toys; arcade games; arcade-type electronic video games; articles of clothing for toys; balloons; balls for games; bath toys; battery operated action toys; board games; sleds; bubble making wand and solution sets; card games; Christmas tree ornaments and decorations; dolls designed to resemble computer game characters; dolls responding to signals from other electronic devices; plush toys designed to resemble computer game characters; plastic toys designed to resemble computer game characters; plush toys responding to signals from other electronic devices; electronic novelty toystoys that electronically recordplay backdistort or manipulate voices and sounds; gambling machines; game controllers for computer games; ice skates; infant toys; inflatable toys; in-line roller skates; interactive hand-held audio-visual games with displays not for use with television receivers; kite reels; kites; mechanical toys; musical toys; parlor games; party favors in the nature of small toys; party games; pinball games; plastic character toys; plush toys; protective padding for playing sportsskateboardingin line skatingbaseballbasketballBMX bicycle motocrossfield hockeyfootballhockeyinline skatinglacrossemartial artsmotocrossmountain bikingskisnowboardsoftballvolleyball; puppets; roller skates; rubber character toys; sailboards; sandbox toys; skateboards; skating boots with skates attached; action skill games; skiing; snow boarding; squeeze toys; stand-alone video output game machines; surf boards; swings; tabletop games; talking dolls; talking toys; toy masks; toy snow globes; toy vehicles; water toys; wind-up toys; stand-alone video game machines for use with external display screens or monitors; building blocks toys; body boards; chess games; apparatus for electronic games other than those adapted for use with an external display screen or monitor; electronic toys; electronic learning toys; battery operated action toys; puzzles; plastic character toys; electronic remote controlled toyscarsrace carsairplanesboats and animal characters
Classe 29
Bacon; bouillon; bouillon concentrates; broth; broth concentrates; butter; caviar; cheesechocolate nut butter; charcuterie; chickenmeatfishpotatoescheesevegetableshellfish croquettes; crystallized fruits; drinks made from dairy products; edible oils and fats; eggs; fruit peel; fishtinned; fruitstinned; food products made from fishfish filetssurimifish cakesfish sticksfish salami and fish pate; frosted fruits; frozen fruits; fruit chips; jelliesjamscompotesfruit and vegetable spreads; maize oil; margarine; marmalade; meat jellies; meat tinned; meat extracts; milk beverages with high milk content; olive oil for food; preserved mushrooms; preserved fruits; preserved vegetables; prepared nuts; pates; peanut butter; peanutsprocessed; peaspreserved; potato chips; potato fritters; preparations for making bouillon; preparations for making soup; raisins; soups; preserved seaweeds for food; yoghurt; processed seafood; saladsgarden saladsfruit saladsvegetable saladschicken saladscaesar saladslegume saladsmullet rose salads; sauerkraut; sausages; sesame oil; seafoodtinned; tofu; tomato purée; vegetable salads; vegetable soup preparation; vegetablestinned; whipped cream
Classe 30
Almond confectionerysugar coated almondsalmond cake and almond paste; aromatic preparations for foodseasoningsspicesstock cubes and processed herbs; starch-based binding agents for ice cream; edible ices; biscuits; bread rolls; buns; cakes; cake powder; caramels candy; cereal based snack food; cereal based snack foodsdried cereal flakes; coffee; cheese flavored snackscheese curls snacks; chewing gums; chocolate; chocolate bars; chocolate based ingredient for use in making beverages; chocolate-based beverages with milk; chocolate coated nuts; chocolate based ingredient for use in confectionery products; chocolate decorations for cakes; chocolate flavored coatingschocolate flavored icings; chocolate itemschocolate for decorating Christmas trees; confectionery made of sugar; chocolate truffles; cocoa; cocoa-based beverages; cocoa beverages with milk; cocoa powder; cocoa preparations for making cocoa beverages; coffee-based beverages; coffee beverages; coffee flavourings; confectionery for decorating Christmas trees; confectionery icessherbets; cookies; cooking salt; corn flakes; corn meal; crackers; curry spices; custard; edible ices; edible decorations for cakes; frozen yoghurt; fruit jellies candy; fruit sauces excluding cranberrysauce and applesauce; flavourings for cakes other than essential oils; gingerbread; honey; herbal teas and herbal infusions; herbal preparations for making beveragesnot for medicinal useherbal flavorings for making beverages; ice cream; ice cream drinks; baking-powder; ketchup; liquorice; macaroni; marzipan; marzipan substitutes; mayonnaise; meat gravies; meat pies; meat tenderizersfor household purposes; oatmeal; pastry; popcorn; pancakes; pasta; pepper; peppers seasonings; pizzas; pretzels; dessert puddings; instant pudding mixes in powder form; ravioli; relishes; rice based snack food; rice cakes; rusks; salad dressings; sandwiches; sherbets ices; rice-basedcereal based and wheat-based snack foods; syrup for flavoring food or beverages; spaghetti; spices; soy sauce; spreads containing chocolate; sweetmeats candy; sushi; sugar; tarts; tea based beverages; teas; tomato sauce; udon noodles; vinegar; condimentsoyster sauce and pepper sauce; wasabi paste; wheat flour; vanilla; waffles
Classe 32
Aerated water; aperitifsnon-alcoholic; beers; cidernon-alcoholic; cocktails (non-alcoholic); energy drinks; essences for making non-alcoholic beverages; fruit drinks and fruit juices; fruit nectarsnon-alcoholic; lemonades; milk of almonds for beverages; mineral water; non-alcoholic drinks and beveragescarbonated beverages and energy shots; non-alcoholic fruit juice beverages; pastilles for effervescing beveragespowders for making soft drinks; powders for effervescing beveragesfruit drinks and whey drinks; smoothies; soda water; soft drinks; sorbets in the form of beverages; syrups for making beverages; fruit juice concentrates; table waters; vegetable drinks and vegetable juices; water beverages; whey beverages
Classe 35
Wholesale and retail store services featuring party favoursplastic and paper jewelryplastic toyspaper hatspaper and plastic whistles and magic setsfestive decorations and ornamentsproducts for decorating roomsclothingjewelry and papersoapsperfumeryessential oilscosmeticshair lotionshair care productstoiletriesdentifricespersonal hygiene productscleaningpolishing and abrasive preparationssubstances for laundry usemanicure toolsnail care preparationsnail polishfalse nailsdietetic substancesfood for babiessanitary preparationscandleswicksspills for lightinggreaseslubricantsoils for paintscutlerycrockerymanicure setsshaving instrumentsrazorsmachines and machine tools for kitchen or household purposesdishwasherswashing machinescooker hoodskitchen stoves and mixershand-held toolsfilmscamerasphoto discsvideo recordersaudio and visual productsaudio and video tapesrecords and discsinstruments and apparatus for the recordingtransmitting and/or reproduction of sounds and/or imagestelevisionscassette tape players and/or recordersvideo cassette and/or disc players and/or recordersradiostelephoneswireless phonesmobile phonesmobile phone casesdecorations and straps for phonescall indicatorscalculating machinescalculatorselectronic and computer gamescinematographic filmslightsfanscooking utensilscake and pastry mouldstoastersovenskitchen utensilsjuice squeezersblenderscuttersscalespansdishescutleryplatescupsglasses and bowlsutensils and containers for serving or storing food and/or beverageschop stickscutting instrumentsporcelainchinawarecrystalwareenamelwaresilverwareglasswareterra-cottawareearthenwareceramicshair dryerslampslamp shades and parts and fittings thereforbaby carriagesballoonsbicycle hornsclocks and watches and accessories and parts and fittings thereforjewellery and imitation jewelleryornamentsgoods in precious metal or coated therewithjewelrywatchesclockssculptures and boxesmusic boxesmusical instrumentspicturesphotographsstationerypaper and cardboard and goods made from these materialscontainersboxesbagsposterstowels and handkerchiefsartists materialspaint brusheswriting instrumentsprinted matterbooksnewspapersmagazines and periodicalsgreeting and Christmas cardsplaying cardspacking and packaging materialspicture frames and standsadhesives for stationery or household purposesgoods made of leather and/or imitations of leatherbagswalletsclothesshoesriding equipment and furniturebags and luggagepurses and walletsumbrellaswalking sticksfurnituremirrorscoat hangers and pegsboxes and containersname platescontainerscombsspongesbrushesarticles for cleaning purposesspectaclesspectacle frames and sunglasses and cases and accessories therefortextile and textile goodsbeddingtable linens and coversnapkinsmatsfurniturehaberdasheryhandkerchiefsarticles of clothingfootwear and headgearproducts from clothingfootwear and headgearswimwearjackets and waterproof jacketsrain wearbeltsunderwearnightwearhatscapssun visorssocksstockingstightsmasquerade costumesjacketsknitwearshirtsmen's shirtouterwearshortsdressesskirtscoatsvestssweaterstiesscarvessweatshirtsrobesbibsclothing for children and infantsshoessports sneakersslippersshoes for the beachcovers and cuffs and buttonsbadgesribbons and braidlace and embroideryhair pins and ornamentsbracesshoe ornamentshat ornamentszipper and zipper fastenerscarpetsrugs and matstoysgames and playthingsdollsfigurinessporting articlessports shoessports drinkssports apparelsports gogglessports equipmentsport caps and hatssports helmetsrings for sportsracketsski equipmentweightshiking gearbicyclescycling equipmentsnowboardingsurfssailswind surfsballsswimming equipmentdiving equipmentequipment for martial artscricket equipmentriding equipment and golf equipmentdecorations for Christmas treesfood and beveragesconfectioneryfloral productsmatchescigarscigarettes and smokers' articles; advertising services; marketing services; organization of exhibitions for commercial or advertising purposes; publication of publicity texts; sales promotion; advertising agencies; business management of performing artists; goods import-export agencies; compilation and systematization of information into computer databases; direct mail advertising services; business management of hotels for others; marketing services; outdoor advertising; personnel recruitment services and employment agencies; publicity agencies; radio advertising; television advertising; on-line advertising on a computer network; procurement services for otherspurchasing fooddrinkstoysoffice suppliesbeddingkitchen utensilsfurniturewatches; rental of advertising time on communication media; rental of office machinery and equipment; rental of vending machines; production of television commercials; rental of advertising space
Classe 38
Telecommunications serviceslocal and long distance transmission of voicedatagraphics by means of telephonetelegraphiccablesatellite transmissions; cable television broadcasting; cellular telephone communication; communications by fiber optic networks; communications by telegrams; communications by telephone; computer aided transmission of messages and images; electronic mail; facsimile transmission; radio broadcasting; sending of telegrams; telegraph services; telephone communication services; television broadcasting; wire serviceelectronic transmission of messages and data; paging services; providing telecommunications connections to a global computer network; providing user access to a global computer network; telecommunications routing and junction services; electronic bulletin board services; teleconferencing services; music broadcasting over the Internet and digital media including through smartphones and tablets; terrestrialcable or satellite broadcasting of radiotelevisionteletext or of data; computer aided transmission of messagesdata and images; services relating to communications by computer terminals; news agency services for electronic transmission; information and advisory services in the field of telecommunications; broadcastingtransmission and dissemination of programsfilmsimagesmusicgamesexcerpts and text via all forms of technology to television setspersonal computers and recorderswireless receptorstelephones and mobile phonespublic screens and any other device or facility capable of receiving such content; communication by consumer video game apparatus; providing information on communication by consumer video game apparatus; communication by arcade video game machines; providing information on communication by arcade video game machines; communication by handheld game apparatus; providing information on communication by handheld game apparatus; message sending
Classe 41
Amusement park and theme park services; animation film and video production services; distribution of radio programs for others; distribution of television programs for others; entertainment in the nature of competitions in the field of computer and video games; entertainment in the nature of live stage performances featuring animated characters; entertainment in the nature of theater productions; entertainment servicesproduction of entertainment television shows and interactive television programs for distribution via televisioncablesatelliteaudio and video mediacartridgeslaser discscomputer discs and electronic means; entertainment servicesproviding online computer games and online video games that are accessible and playable via mobile and cellular phones and other wireless devices; entertainment servicesthe provision of continuing entertainment and news programs featuring entertainment information delivered by communication and computer networks; entertainment serviceslivetelevised and movie appearances by a professional entertainer; entertainment servicesproviding non-downloadable musical performancesmusical videosrelated film clipsphotographs and other multimedia entertainment materials featuring animated cartoon characters via a web site; entertainment servicesproviding information in the field of musicvideo gamesanimated cartoon characters a web site; entertainment servicesproviding on-line computer games; entertainment servicesproviding touch and voice driven online computer games for digital mobile devices; entertainmenta continuing entertainment animated cartoon show broadcasted over global and local area computer networks; multimedia publishing of booksmagazinesjournalssoftwaregamesmusicelectronic publications; on-line gaming services; arranging or organizing of online multiplayer video game tournaments; production and provision of entertainment and news via communication and computer networksproduction and distribution of entertainment and news television programs for othermultimedia production services; production of audiovideomultimedia recordings; production of radio and television programs; production of sound recordings; productiondistribution of motion pictures and rental of motion picture films; providing non-downloadable audio and video files in the field of entertainment relating to interactive computer game softwareinteractive video game software and interactive computer and video games; providing online computer game services from a mobile phone network; providing news and information in the field of entertainment regarding interactive computer game softwareinteractive video game software and interactive computer and video gamesvia electronicwireless and computer networks; providing non-downloadable video and audio recordings about animated cartoon characters made within computer games via a website ; providing online computer and video games accessed and played via electronicwireless and computer networks; rental of sound recordings; video production services; video film production; video recording services
Classe 42
Computer graphics design servicescreation of computer generated cartoon animated images; consulting services in the field of designselectionimplementation and use of computer hardware and software systems for others; computer programming; computer software consulting; computer systems analysis; conversion of data from physical to electronic media; design and development of on-line computer software systems; developmentconsultancy on and designing of computer software; developmentconsultancy on and designing of touch and voice driven computer software for electronic digital mobile devices; engineering in the field of computer science; hosting a web site featuring user generated content; providing computer software that may be downloaded from a global computer network; configuringmaintenance and servicing of computer software; updating and maintenance of computer softwareincluding touch and voice driven computer software for electronic digital mobile devices