Dado oficial do INPI

mi

Sabia que essa marca já está registrada no Brasil?

Antes de investir em nome, identidade e divulgação, valide risco de colisão e estratégia de registro para não perder tempo nem budget.

Registro de marca em vigor (Madri)Tipo: MistaEscritório: Brasil

Ativar vigilância desta marca Falar com especialista

Snapshot rápido

ST13

BR500000501650491

Classe

2, 3, 7, 8, 9, 10, 11, 12, 14, 15, 16, 18, 21, 24, 25, 28, 35, 36, 37, 38, 39, 41, 42, 45

Pedido

501650491

Registro

501650491

Ver no INPI

Andamento no INPI

Depósito13/07/21
Publicação03/05/22
Exame
Deferimento
Concessão28/05/24
Vigente13/07/31

Registro concedido em 28/05/2024 e em vigor até 13/07/2031, quando precisa ser renovado.

Proteção válida até:13/07/2031

Última movimentação publicada pelo INPI: 19/05/2026. Atualizamos a cada nova RPI, publicada semanalmente.

Diagnóstico de risco e oportunidade

Leitura executiva para decisão de naming, protocolo e monitoramento.

Situação INPI

Registro de marca em vigor (Madri)

Tipo de processo

Pedido e registro

Eventos registrados

Atualização mais recente

19/05/2026

Tipo de marca

Mista

Classes Nice

2, 3, 7, 8, 9, 10, 11, 12, 14, 15, 16, 18, 21, 24, 25, 28, 35, 36, 37, 38, 39, 41, 42, 45

Data de depósito

13/07/2021

Data de registro

28/05/2024

Data de expiração

13/07/2031

Dados completos do processo

Campos estruturados da autoridade responsável e do histórico oficial.

Natureza

Madri Produto/Serviço

Escritório responsável

Brasil

Tipo de titular

NÃO RESIDENTE

Localização do titular

Titulares e representantes

Titulares

XIAOMI INC.

Representantes

Gusmão & LabrunieVer perfil do escritório

Classificação técnica

Classes Nice

Classe 2Classe 3Classe 7Classe 8Classe 9Classe 10Classe 11Classe 12Classe 14Classe 15Classe 16Classe 18Classe 21Classe 24Classe 25Classe 28Classe 35Classe 36Classe 37Classe 38Classe 39Classe 41Classe 42Classe 45

Códigos Vienna

26.4.1826.4.527.5.126.4.426.4.2427.5.24

Produtos e serviços

Classe 2

Dyeswatercolour paintsfood dyestoner cartridges, filled, for printers and photocopiersink for printers and photocopiersink cartridges, filled, for printers and photocopierscoatings [paints]anti-tarnishing preparations for metalsmastic [natural resin]

Classe 3

Baby wipes impregnated with cleaning preparationscakes of toilet soapdetergentshining preparations [polish]sharpening preparationsessential oilscosmeticsdentifricespotpourris [fragrances]non-medicated mouth washes for petsair fragrancing preparations

Classe 7

Agricultural machinesagricultural implements other than hand-operatedaerating pumps for aquariamechanized livestock feederselectronic feeders for animalsmilking machineshair cutting machines for animalswoodworking machinespapermaking machinesdiaper producing equipmentprinting pressesdarning machinesdyeing machinesfood preparation machines, electromechanicalbeverage preparation machines, electromechanicalbrewing machinestobacco processing machinesleather-working machinesironing machinesmachines for the bicycle industrymachines for the ceramic industry [including ceramic machines for the construction industry]engraving machinesindustrial inkjet printing machinesmachines for battery industrycord making machinespen making machineslight bulb making machineselectric vacuum food sealers for household purposeselectric juicersjuice extractors, electricdishwasherscoffee grinders, other than hand-operatedkitchen machines, electricblenders, electric, for household purposesmills for household purposes, other than hand-operatedfood processors, electricelectrical coffee grindersmixing machineswashing machines [laundry]wringing machines for laundrydisintegratorsembossing machinesglass-working machineselectromechanical machines for chemical industryrinsing machinescutters [machines]drilling rigs, floating or non-floatingmixers [machines]whitewashing machineslifting apparatushandling apparatus for loading and unloadingconveyors [machines]electric hammersfoundry machinessteam condensers [parts of machines]carburettershydraulic turbinesindustrial robotshandling machines, automatic [manipulators]cowlings [parts of machines]electric wire and cable manufacturing machineselectromotion screwdriverelectric hand-held drillshand-held electric drills [excluding electric coal drill]painting machinesdynamosfilters for cleaning cooling air, for enginesmotors, electric, other than for land vehiclespumps [machines]pneumatic pumpsvalves [parts of machines]aerocondensershydraulic couplerstransmissions for machinescontrol mechanisms for machines, engines or motorsbearings [parts of machines]belts for machinesrubber tracks being parts of crawlers on construction machineswelding apparatus, gas-operatedrechargeable sweepersfloor scrubbing machinesmachines and apparatus for cleaning, electricelectric cordless sweeperscordless vacuum cleanersvacuum cleanerselectric vacuum cleanerssteam mopsbrushes for vacuum cleanersdust filters and bags for vacuum cleanerssifting installationscurtain drawing devices, electrically operateddrums [parts of machines]3D printersshoe polishers, electricracket stringing machinesvending machineslabellers [machines]robotic exoskeleton suits, other than for medical purposes3D printing penselectroplating machines

Classe 8

Abrading instruments [hand instruments]agricultural implements, hand-operatedgarden tools, hand-operatedinstruments and tools for skinning animalsharpoonsrazors, electric or non-electricelectric hair crimpernail clippersbeard clippersrazor bladeselectric irons for styling hairelectric hair straightenersscrewdrivers, non-electricflat ironstweezersknivesside arms, other than firearmstable cutlery [knives, forks and spoons]handles for hand-operated hand toolshand tools, hand-operated

Classe 9

Computer software applications, downloadablecomputer peripheral devicesnotebook computersmobile phone software applications, downloadablelaser printerstablet computerstelepresence robotshumanoid robots with artificial intelligencecomputersphoto printersink-jet document printerstoner cartridges, unfilled, for printers and photocopiersink cartridges, unfilled, for printers and photocopiersliquid crystal displaysLED displaysmemory cardsUSB flash drivescomputer keyboardsmouse [computer peripheral]mouse padssmartwatches [data processing]electronic pocket translatorsoperating system programstouch screen penselectronically encoded identity wristbandssmartglassescases adapted for computersencoded identification bracelets, magneticprocessors [central processing units]graphics processor units (gpus)computer programs, recordedmonitors [computer hardware]couplers [data processing equipment]digital to analogue converterspedometersapparatus to check frankingautomated teller machines [ATM]mechanisms for coin-operated apparatusdictating machineshologramshemline markersvoting machinesface recognition apparatusfingerprint identifierphotocopiers [photographic, electrostatic, thermic]bathroom scalesbody fat scale for household purposeselectronic bathroom scalesscalesmeasuresdigital signscell phoneswearable activity trackersGlobal Positioning System [GPS] apparatusnetwork routerssmartphonesnavigational instrumentselectro-dynamic apparatus for the remote control of signalssound locating instrumentssatellite navigational apparatusequipment for communication networknavigation apparatus for vehicles [on-board computers]selfie sticks for mobile phonessmartphones in the shape of a watchintercomstransmitters of electronic signalswireless routerstransponderscommunication modemswireless local area network controllerscell phone casesprotective films adapted for smartphoneswaterproof cases for smart phonesmonopods used to take photographs by positioning a smartphone or camera beyond the normal range of the armtelevision displaysmicrophonesaudio- and video-receivershead-mounted video displaysweb camerasaudio equipmentelectronic audible devices with booksnoise cancelling earphonesradio setsrearview cameras for vehiclescamcorder waterproof casessecurity surveillance robotscabinets for loudspeakersearphonecamcorderselectronic monitoring apparatustelevision apparatusear pads for headphonesbluetooth earphonesheadphoneselectronic book readersteaching apparatus with artificial intelligenceevent data recordersset-top boxeswearable video display monitorsvirtual reality headsetsmultimedia projectorscameras [photography]mini beam projectorsselfie sticks [hand-held monopods]measuring apparatusair analysis apparatushygrometerstelemeterstire pressure gaugesautomatic indicators of low pressure in vehicle tyrestemperature indicatorsconnected bracelets [measuring instruments]laboratory robotsteaching robotsaudiovisual teaching apparatusteaching apparatusmeasuring devices, electricinductors [electricity]simulators for the steering and control of vehiclesstereoscopesmaterials for electricity mains [wires, cables]USB cablesadapter cables for headphonessemi-conductorselectronic chipsintegrated circuitsmagnetic materials and devicesamplifiersconductors, electricelectric plugssensorspower adaptersswitches, electricalarm sensorsmotion recognizing sensorsplugboardsoptical sensorstemperature sensorsplugs, sockets and other contacts [electric connections]power adaptorselectric socketstouch sensorstouchscreen sensorsadapter plugsconnections for electric lineselectricity switchboard of high or low voltageplug connectorsvideo screensremote control apparatusremote controls for household purposesoptical fibers [fibres] [light conducting filaments]electric installations for the remote control of industrial operationslightning conductorselectrolysersfire extinguishing apparatusradiological apparatus for industrial purposesprotection devices for personal use against accidentsbicycle helmetsgogglesprotective helmetslife saving apparatus and equipmenttheft prevention installations, electricbiometric fingerprint door lockselectronic lockselectromagnetic locksalarmsalarms for the detection of inflammable gasessmoke detectorspeepholes [magnifying lenses] for doorsdigital door lockselectric door bellseyeglassessunglasses3D glassescyclists' glassesUSB chargersbattery charge deviceswireless chargersbattery chargers for mobile phonesbatteries, electricchargers for electric batteriesmobile power supply [rechargeable battery]cell phone battery chargers for use in vehiclesanimated cartoonssports whistlesegg-candlersdog whistlesdecorative magnetselectrified fencesfridge magnets

Classe 10

Surgical robotsvibromassage apparatusesthetic massage apparatusthermometers for medical purposesmassage apparatusmassaging apparatus for personal usesphygmomanometersdental apparatus, electricelectric acupuncture instrumentssoporific pillows for insomniasanitary masks for medical purposesteething ringscontraceptives, non-chemicalrobotic exoskeleton suits for medical purposesorthopaedic articlessuture materials

Classe 11

Lampslighting apparatusdesk lampselectric night lightsportable headlampsceiling lightslight bulbstorches for lightinglights for vehiclesgermicidal lamps for purifying aircurling lampsoil lampselectric saucepanspressure cookers [autoclaves], electrictortilla presses, electricgas burnerskettles, electricelectric toasters [for household purposes]electrical rice cookers / electric rice cookerselectric kettles [for household purposes]electromagnetic induction cookerselectric frying pansair fryerselectric egg boilerselectric coffee machines / electric coffee brewersmicrowave oven (kitchen appliance)soya milk making machines, electricbaking ovens [for household purposes]electric cooking stoves [for household purposes]electrically-heated mugslava rocks for use in barbecue grillsrefrigeratorsair purifiershumidifiers for household purposesair sterilisersgarment steamersdehumidifiers for household purposeselectric fanshumidifiersair filtering installationsextractor hoods for kitchensair conditionersclothes dryerselectric clothes dryersfans [air-conditioning]air reheatershair driers [dryers]water heatersfog generatorsautomatic faucetsornamental fountainshydromassage bath apparatusheating lamps for bathhand drying apparatus for washroomssanitary apparatus and installationswater dispenserselectric water purifiers for household purposeswater filtering apparatusapparatus for filtering drinking waterpocket warmersradiators, electriclighterspolymerisation installations

Classe 12

Rolling stock for railwaysautomobilesdriverless cars [autonomous cars]push scooters [vehicles]bicyclescollapsible bicyclesself-balancing scootersgo-kartselectric bicycleself balancing electric scooterselectrically powered scooters [vehicles]pumps for bicycle tyresbicycle pumpspushchairsfold-up pushchairswheelchairstrolleysrescue sledstyres for vehicle wheelsrepair outfits for inner tubesphotography droneswater vehiclestreads for vehicles [roller belts]roof-mounted luggage racks for vehiclessafety seats for children, for vehicleselectrical anti-theft installations for vehicleselectric vehiclesvehicles for locomotion by land, water or railremote control vehicles, other than toys

Classe 14

Precious metalsboxes of precious metaljewellery boxesworks of art of precious metalnecklaces [jewellery, jewelry (Am.)]figurines [statuettes] of precious metaljewellerywristwatcheswatch strapsalarm clocks

Classe 15

Electronic musical instrumentspianosguitarsviolinshorns [musical instruments]musical instrumentsbags specially adapted for holding musical instrumentsmusical boxesmusic stands

Classe 16

Paperblack paperboard for photographylaser printing papertoilet papernapkin paperadvertisement boards of paper or cardboardstickerscalendarswriting paper padsenvelopesfigurines made from paperprinted publicationschildren's books incorporating electronic audible devicenewsletterspicturesbags [envelopes, pouches] of paper or plastics, for packaginggarbage bags of paper or of plasticsstapling presses [office requisites]office requisites, except furniturestationeryIndian inksstamps [seals]pensadhesive bands for stationery or household purposesdrawing instrumentsdrawing materialsinking ribbonsteaching materials [except apparatus]tailors' chalkarchitects' models

Classe 18

Leather, unworked or semi-workedbagstravelling trunksschool bagsgym bagssmall backpacksrucksackstrunks [luggage]all-purpose sports bagstrimmings of leather for furnitureleather thongsumbrellaswalking sticksclothing for pets

Classe 21

Containers for household or kitchen usecooking potsfrying pansdeep fryers, non-electricrice cooking pots [non-electric]cupsfood preserving jars of glassceramics for household purposesworks of art made of crystalthermos cupscoffee filters not of paper being part of non-electric coffee makersclothes racks, for drying / clothes drying hangerstoilet utensilstrash cansdrying racks for laundryheight adjustable ceiling-mounted drying racks for laundrytoothbrush holderscandle warmers, electric and non-electricaromatic oil diffusers, other than reed diffusers, electric and non-electriccombsbrushesmaterial for brush-makingwater apparatus for cleaning teeth and gumstoothbrushes, electricheads for electric toothbrushesmanual toothbrushestoothbrushestoothpickscosmetic utensilsthermally insulated containers for foodice cube trayscloth for washing floorsmopscleaning instruments, hand-operatedlint removers, electric or non-electricglass, unworked or semi-worked, except building glassanimal activated livestock waterersanimal-activated pet feedersanimal activated animal feedersindoor terrariums [vivariums]plug-in diffusers for mosquito repellentsultrasonic mosquito repellersultrasonic pest repellers

Classe 24

Fabricfiltering materials of textilefiltering clothsilk fabrics for printing patternsfeltface towels of textilebed linenquiltstablemats of textilecurtains of textilecurtains of textile or plasticfitted toilet lid covers of fabricmarabouts [cloth]banners of textile or plasticshroudshousehold linen

Classe 25

Tee-shirtssports jerseyssports vestssports singletslayettes [clothing]swimsuitsraincoatsmasquerade costumesshoessports shoescaps being headwearhosierygloves [clothing]riding glovesnecktiesscarfsgirdleswimplessashes for wearshower capssleep maskshairdressing capesclothingsports sweatbands

Classe 28

Gamesapparatus for gameselectronic games for the teaching of childrenvideo game interactive control floor pads or matsslides [playthings]building blocks, large sizesmart electronic toy vehiclestoy robotstoy modelssmart toysdrones [toys]toystoy vehiclesbaby gymsbattery operated toysplay sets for action figuresscooters [toys]building blocks [toys]remote-controlled toy vehiclescube-type puzzlesballs for gamesstationary exercise bicyclesexercise steppersrunning machinesbody-training apparatusbows for archerymachines for physical exercisesjump ropesskateboardshunting game callsswimming pools [play articles]protective paddings [parts of sports suits]gloves for gamesin-line roller skatesornaments for Christmas trees, except lights, candles and confectioneryrods for fishingtwirling batonscamouflage screens [sports articles]scratch cards for playing lottery gamesgrips for racketsgrip tapes for golf clubs

Classe 35

Advertisingpay per click advertisingonline advertising on a computer networkpresentation of goods on communication media, for retail purposesproviding business information via a web sitecommercial intermediation servicescommercial administration of the licensing of the goods and services of otherscommercial information and advice for consumers in the choice of products and servicesprovision of an on-line marketplace for buyers and sellers of goods and servicessales promotion for othersprocurement services for others [purchasing goods and services for other businesses]import-export agency servicesrecruitmentsearch engine optimization for sales promotionconducting data searches in computer files for otherscompiling indexes of information for commercial or advertising purposessponsorship searchrental of vending machinesrental of sales standsretail services for pharmaceutical, veterinary and sanitary preparations and medical supplies

Classe 36

Providing information relating to insurancefinancial managemente-wallet payment servicesjewellery appraisalreal estate agency servicesfinancial customs brokerage servicessurety servicescharitable fund raisingfiduciarylending against security

Classe 37

Providing construction informationbuilding of fair stalls and shopsupholsteringheating equipment installation and repairinstallation, maintenance and repair of computer hardwareinterference suppression in electrical apparatusmedical apparatus installation and repairmotor vehicle maintenance and repairairplane maintenance and repairshipbuildingphotographic apparatus repairclock and watch repairinstallation, changing, replacement and repair of locksre-tinningrepair of rubber tiresfurniture restorationcleaning of clothingsterilization of medical instrumentselevator installation and repairburglar alarm installation and repairtelephone repairpump repair and maintenanceparasol repairartificial snow-making servicesrestoration of works of arttuning of musical instrumentsrental of drainage pumpsswimming-pool maintenancerepair of power lineshand tool repairinstallation and repair of entertainment and sports equipmentsrental of dish washing machinesrepair of binocularsrepair of toys or dollsrepair of game machines and apparatusrepair and maintenance of smartphonestelephone installation and repaircell phone battery charging servicesrental of carpet cleaning machinesmaintenance and repair of mobile phonescleaning services for extractor hoodsmaintenance and repair of telescopesall the aforementioned services, are not related to underground oil well drilling services

Classe 38

News agency serviceswireless broadcastingmessage sendingproviding telecommunication channels for teleshopping servicescomputer aided transmission of messages and imagesproviding internet chatroomsproviding user access to global computer networksproviding online forumsvideo-on-demand transmissionteleconferencing servicesvideoconferencing servicescommunications by computer terminalstransmission of digital filesproviding access to databases

Classe 39

Transportation logisticsfreightingunloading cargopackaging of goodspilotinghaulingvehicle breakdown towing servicesfreight [shipping of goods]car transportreplenishment of vending machinesair transportcar rentalcar sharing serviceshorse rentalstoragerental of diving suitsdistribution of energyoperating canal lockscourier services [messages or merchandise]parcel deliverydelivery of goodstravel reservationtransport by pipelinerental of wheelchairslaunching of satellites for othersbottling servicespush-chair rental

Classe 41

Instruction servicescorrespondence coursesarranging and conducting of seminarsorganization of competitions [education or entertainment]lending library servicesproviding on-line electronic publications, not downloadableon-line publication of electronic books and journalsdistribution of video tapesproviding online videos, not downloadableproduction of radio and television programmesvideo productionentertainment servicesentertainer servicesgame services provided on-line from a computer networkhealth club services [health and fitness training]toy rentalgames equipment rentalconducting guided toursart exhibitionsanimal trainingmodelling for artistsorganization of lotteries [retailing of lottery tickets]rental of indoor aquariaoperating of lotteries [retailing of lottery tickets]all the aforementioned services are not related to the field of vocal music

Classe 42

Research and development of new products for otherstechnological researchquality system control and conformity assessmentproduct quality testing servicessurveyingmeteorological informationmaterial testingpackaging designdesign of telephonesdesign of interior decordress designingsoftware design and developmentresearch and development of computer softwareupdating and maintenance of computer softwarecloud computingplatform as a service [PaaS]software as a service [SaaS]consultancy in the design and development of computer hardwareproviding information on computer technology and programming via a web siteelectronic data storageauthenticating works of artgraphic arts designcloud seedinghandwriting analysis [graphology]cartography servicesrental of meters for the recording of energy consumption

Classe 42

certificação de sistema de qualidade

Classe 45

Monitoring of burglar and security alarmslifeguard servicesmonitoring of security systemschaperoningpersonal wardrobe styling consultancyfunerary undertakingopening of security locksonline social networking servicesfire-fightingorganization of religious meetingsadoption agency serviceslost property returnrental of safesgenealogical researchplanning and arranging of wedding ceremoniesreleasing doves for special occasionsdating servicesleasing of internet domain namesintellectual property consultancy

Publicações

Histórico de despachos e eventos da marca no INPI.

12 publicações encontradas

IPAS532

Requerimento não provido (mantida a concessão)

Protocolo: 850240610951 (22/11/2024) Petição (tipo): Nulidade administrativa de registro de marca (336.1) Requerente: NATIONAL HELICOPTER CENTER MIL&KAMOV JOINT STOCK COMPANY

RPI 2889

19/05/2026

IPAS905

Anotação de restrição de especificação em designação

Protocolo: 1963545801 (07/05/2025) Petição (tipo): Protocolo de Madri - RESTRICT Detalhes do despacho:Anotada a restrição da especificação das NCL (11) 12 conforme comunicação da Secretaria Internacional da OMPI.

RPI 2844

08/07/2025

IPAS400

Notificação de instauração de processo de nulidade a requerimento

Protocolo: 850240610951 (22/11/2024) Petição (tipo): Nulidade administrativa de registro de marca (336.1) Requerente: NATIONAL HELICOPTER CENTER MIL&KAMOV JOINT STOCK COMPANY Detalhes do despacho:Referente à classe NCL(11) 12.

RPI 2826

06/03/2025

IPAS699

Ato de prejudicar petição

Protocolo: 850240614517 (25/11/2024) Petição (tipo): Nulidade administrativa de registro de marca (336.1) Requerente: NATIONAL HELICOPTER CENTER MIL&KAMOV JOINT STOCK COMPANY Detalhes do despacho:Petição prejudicada pela perda de objeto, tendo em vista solicitação em duplicidade em relação à petição 850240610951.

RPI 2824

18/02/2025

IPAS270

Deferimento da petição

Protocolo: 850240472308 (12/09/2024) Petição (tipo): Nomeação, destituição ou substituição de procurador [em processo de registro] (385.1) Requerente: XIAOMI INC. Procurador: Jacques Labrunie Detalhes do despacho:Nomeado procurador Jacques Labrunie com poderes para representar o titular do processo perante o INPI.

RPI 2805

08/10/2024

IPAS577

Emissão de folha de rosto de cópia reprográfica simples

Protocolo: 850240466032 (10/09/2024) Petição (tipo): Cópia reprográfica simples (824.3) Requerente: GUSMÃO E LABRUNIE ADVOGADOS Procurador: Jacques Labrunie

RPI 2803

24/09/2024

IPAS770

Concessão de registro em designação

RPI 2786

28/05/2024

IPAS535

Recurso provido parcialmente (decisão reformada para: Deferimento parcial)

Protocolo: 850220552997 (12/12/2022) Petição (tipo): Recurso contra indeferimento de pedido de registro de marca (3000.1) Requerente: XIAOMI INC. Procurador: Jacques Labrunie Detalhes do despacho:Reformado o indeferimento com relação as classes NCL(11) 07 e 12.

RPI 2774

05/03/2024

IPAS905

Anotação de restrição de especificação em designação

Protocolo: 1770127201 (31/10/2023) Petição (tipo): Protocolo de Madri - RESTRICT Detalhes do despacho:Restringidos itens na especificação da classe 37 conforme comunicação da Secretaria Internacional da OMPI.

RPI 2774

05/03/2024

IPAS360

Notificação de recurso

RPI 2723

14/03/2023

IPAS781

Deferimento parcial de designação

Detalhes do despacho: Fica ainda consignada, a título de subsídio a eventual recurso, a identificação das seguintes anterioridades, ainda não decididas, consideradas igualmente colidentes com o presente sinal: 922895945, marca ?MI-REPAIR?; 501569666, marca ?MI?. A marca reproduz ou imita os seguintes registros de terceiros, sendo, portanto, irregistrável de acordo com o inciso XIX do Art. 124 da LPI. As anterioridades impeditivas identificadas na busca realizada em cada classe do pedido são as seguintes: NCL(11-0)2: Processo 830067604 (MI MARKEM-IMAJE), NCL(11-0)3: Processo 916150631 (Óleos da Mi), Processo 917637810 (MI MARIA IVAN), NCL(11-0)7: Processo 815915365 (M I), Processo 902046470 (MI MARF INOX), Processo 901422673 (MI METALÚRGICA IMBRIANI), Processo 830067590 (MI MARKEM-IMAJE), NCL(11-0)12: Processo 907527698 (M I), Processo 915843439 (MI-PILOT), NCL(11-0)25: Processo 830213910 (MI), NCL(11-0)36: Processo 904186652 (MI MERCADO DE IMÓVEIS), Processo 910660611 (MI CONSTRUTORA DE OBRAS), Processo 916630900 (Mi Seguros), Processo 918364175 (MI MARIÁ IMOVEIS), NCL(11-0)37: Processo 828662762 (M-I SWACO), Processo 901055492 (M.I. EQUIPAMENTOS), Processo 828662711 (M-I), Processo 830067647 (MI MARKEM-IMAJE), Processo 910660565 (MI CONSTRUTORA DE OBRAS), Processo 922301590 (CELL MI), NCL(11-0)41: Processo 819995290 (MI), Processo 831149485 (MI MUSICIANS INSTITUTE) e NCL(11-0)45: Processo 922637369 (MI MESTRE INVESTIDOR). Art. 124 - Não são registráveis como marca: XIX - reprodução ou imitação, no todo ou em parte, ainda que com acréscimo, de marca alheia registrada, para distinguir ou certificar produto ou serviço idêntico, semelhante ou afim, suscetível de causar confusão ou associação com marca alheia; As descrições "operação de loterias" na classe NCL(11) 41 foram substituídas por "operação de loterias [venda de bilhetes de loteria]".Realizada alteração na especificação da NCL(11) 42 para melhor adequação à classe e natureza reivindicadas, com substituição do termo 'certificação' por 'controle de qualidade/avaliação da conformidade'.