Classe 2
Dyeswatercolour paintsfood dyestoner cartridges, filled, for printers and photocopiersink for printers and photocopiersink cartridges, filled, for printers and photocopierscoatings [paints]anti-tarnishing preparations for metalsmastic [natural resin]
Classe 3
Baby wipes impregnated with cleaning preparationscakes of toilet soapdetergentshining preparations [polish]sharpening preparationsessential oilscosmeticsdentifricespotpourris [fragrances]non-medicated mouth washes for petsair fragrancing preparations
Classe 7
Agricultural machinesagricultural implements other than hand-operatedaerating pumps for aquariamechanized livestock feederselectronic feeders for animalsmilking machineshair cutting machines for animalswoodworking machinespapermaking machinesdiaper producing equipmentprinting pressesdarning machinesdyeing machinesfood preparation machines, electromechanicalbeverage preparation machines, electromechanicalbrewing machinestobacco processing machinesleather-working machinesironing machinesmachines for the bicycle industrymachines for the ceramic industry [including ceramic machines for the construction industry]engraving machinesindustrial inkjet printing machinesmachines for battery industrycord making machinespen making machineslight bulb making machineselectric vacuum food sealers for household purposeselectric juicersjuice extractors, electricdishwasherscoffee grinders, other than hand-operatedkitchen machines, electricblenders, electric, for household purposesmills for household purposes, other than hand-operatedfood processors, electricelectrical coffee grindersmixing machineswashing machines [laundry]wringing machines for laundrydisintegratorsembossing machinesglass-working machineselectromechanical machines for chemical industryrinsing machinescutters [machines]drilling rigs, floating or non-floatingmixers [machines]whitewashing machineslifting apparatushandling apparatus for loading and unloadingconveyors [machines]electric hammersfoundry machinessteam condensers [parts of machines]carburettershydraulic turbinesindustrial robotshandling machines, automatic [manipulators]cowlings [parts of machines]electric wire and cable manufacturing machineselectromotion screwdriverelectric hand-held drillshand-held electric drills [excluding electric coal drill]painting machinesdynamosfilters for cleaning cooling air, for enginesmotors, electric, other than for land vehiclespumps [machines]pneumatic pumpsvalves [parts of machines]aerocondensershydraulic couplerstransmissions for machinescontrol mechanisms for machines, engines or motorsbearings [parts of machines]belts for machinesrubber tracks being parts of crawlers on construction machineswelding apparatus, gas-operatedrechargeable sweepersfloor scrubbing machinesmachines and apparatus for cleaning, electricelectric cordless sweeperscordless vacuum cleanersvacuum cleanerselectric vacuum cleanerssteam mopsbrushes for vacuum cleanersdust filters and bags for vacuum cleanerssifting installationscurtain drawing devices, electrically operateddrums [parts of machines]3D printersshoe polishers, electricracket stringing machinesvending machineslabellers [machines]robotic exoskeleton suits, other than for medical purposes3D printing penselectroplating machines
Classe 8
Abrading instruments [hand instruments]agricultural implements, hand-operatedgarden tools, hand-operatedinstruments and tools for skinning animalsharpoonsrazors, electric or non-electricelectric hair crimpernail clippersbeard clippersrazor bladeselectric irons for styling hairelectric hair straightenersscrewdrivers, non-electricflat ironstweezersknivesside arms, other than firearmstable cutlery [knives, forks and spoons]handles for hand-operated hand toolshand tools, hand-operated
Classe 9
Computer software applications, downloadablecomputer peripheral devicesnotebook computersmobile phone software applications, downloadablelaser printerstablet computerstelepresence robotshumanoid robots with artificial intelligencecomputersphoto printersink-jet document printerstoner cartridges, unfilled, for printers and photocopiersink cartridges, unfilled, for printers and photocopiersliquid crystal displaysLED displaysmemory cardsUSB flash drivescomputer keyboardsmouse [computer peripheral]mouse padssmartwatches [data processing]electronic pocket translatorsoperating system programstouch screen penselectronically encoded identity wristbandssmartglassescases adapted for computersencoded identification bracelets, magneticprocessors [central processing units]graphics processor units (gpus)computer programs, recordedmonitors [computer hardware]couplers [data processing equipment]digital to analogue converterspedometersapparatus to check frankingautomated teller machines [ATM]mechanisms for coin-operated apparatusdictating machineshologramshemline markersvoting machinesface recognition apparatusfingerprint identifierphotocopiers [photographic, electrostatic, thermic]bathroom scalesbody fat scale for household purposeselectronic bathroom scalesscalesmeasuresdigital signscell phoneswearable activity trackersGlobal Positioning System [GPS] apparatusnetwork routerssmartphonesnavigational instrumentselectro-dynamic apparatus for the remote control of signalssound locating instrumentssatellite navigational apparatusequipment for communication networknavigation apparatus for vehicles [on-board computers]selfie sticks for mobile phonessmartphones in the shape of a watchintercomstransmitters of electronic signalswireless routerstransponderscommunication modemswireless local area network controllerscell phone casesprotective films adapted for smartphoneswaterproof cases for smart phonesmonopods used to take photographs by positioning a smartphone or camera beyond the normal range of the armtelevision displaysmicrophonesaudio- and video-receivershead-mounted video displaysweb camerasaudio equipmentelectronic audible devices with booksnoise cancelling earphonesradio setsrearview cameras for vehiclescamcorder waterproof casessecurity surveillance robotscabinets for loudspeakersearphonecamcorderselectronic monitoring apparatustelevision apparatusear pads for headphonesbluetooth earphonesheadphoneselectronic book readersteaching apparatus with artificial intelligenceevent data recordersset-top boxeswearable video display monitorsvirtual reality headsetsmultimedia projectorscameras [photography]mini beam projectorsselfie sticks [hand-held monopods]measuring apparatusair analysis apparatushygrometerstelemeterstire pressure gaugesautomatic indicators of low pressure in vehicle tyrestemperature indicatorsconnected bracelets [measuring instruments]laboratory robotsteaching robotsaudiovisual teaching apparatusteaching apparatusmeasuring devices, electricinductors [electricity]simulators for the steering and control of vehiclesstereoscopesmaterials for electricity mains [wires, cables]USB cablesadapter cables for headphonessemi-conductorselectronic chipsintegrated circuitsmagnetic materials and devicesamplifiersconductors, electricelectric plugssensorspower adaptersswitches, electricalarm sensorsmotion recognizing sensorsplugboardsoptical sensorstemperature sensorsplugs, sockets and other contacts [electric connections]power adaptorselectric socketstouch sensorstouchscreen sensorsadapter plugsconnections for electric lineselectricity switchboard of high or low voltageplug connectorsvideo screensremote control apparatusremote controls for household purposesoptical fibers [fibres] [light conducting filaments]electric installations for the remote control of industrial operationslightning conductorselectrolysersfire extinguishing apparatusradiological apparatus for industrial purposesprotection devices for personal use against accidentsbicycle helmetsgogglesprotective helmetslife saving apparatus and equipmenttheft prevention installations, electricbiometric fingerprint door lockselectronic lockselectromagnetic locksalarmsalarms for the detection of inflammable gasessmoke detectorspeepholes [magnifying lenses] for doorsdigital door lockselectric door bellseyeglassessunglasses3D glassescyclists' glassesUSB chargersbattery charge deviceswireless chargersbattery chargers for mobile phonesbatteries, electricchargers for electric batteriesmobile power supply [rechargeable battery]cell phone battery chargers for use in vehiclesanimated cartoonssports whistlesegg-candlersdog whistlesdecorative magnetselectrified fencesfridge magnets
Classe 10
Surgical robotsvibromassage apparatusesthetic massage apparatusthermometers for medical purposesmassage apparatusmassaging apparatus for personal usesphygmomanometersdental apparatus, electricelectric acupuncture instrumentssoporific pillows for insomniasanitary masks for medical purposesteething ringscontraceptives, non-chemicalrobotic exoskeleton suits for medical purposesorthopaedic articlessuture materials
Classe 11
Lampslighting apparatusdesk lampselectric night lightsportable headlampsceiling lightslight bulbstorches for lightinglights for vehiclesgermicidal lamps for purifying aircurling lampsoil lampselectric saucepanspressure cookers [autoclaves], electrictortilla presses, electricgas burnerskettles, electricelectric toasters [for household purposes]electrical rice cookers / electric rice cookerselectric kettles [for household purposes]electromagnetic induction cookerselectric frying pansair fryerselectric egg boilerselectric coffee machines / electric coffee brewersmicrowave oven (kitchen appliance)soya milk making machines, electricbaking ovens [for household purposes]electric cooking stoves [for household purposes]electrically-heated mugslava rocks for use in barbecue grillsrefrigeratorsair purifiershumidifiers for household purposesair sterilisersgarment steamersdehumidifiers for household purposeselectric fanshumidifiersair filtering installationsextractor hoods for kitchensair conditionersclothes dryerselectric clothes dryersfans [air-conditioning]air reheatershair driers [dryers]water heatersfog generatorsautomatic faucetsornamental fountainshydromassage bath apparatusheating lamps for bathhand drying apparatus for washroomssanitary apparatus and installationswater dispenserselectric water purifiers for household purposeswater filtering apparatusapparatus for filtering drinking waterpocket warmersradiators, electriclighterspolymerisation installations
Classe 12
Rolling stock for railwaysautomobilesdriverless cars [autonomous cars]push scooters [vehicles]bicyclescollapsible bicyclesself-balancing scootersgo-kartselectric bicycleself balancing electric scooterselectrically powered scooters [vehicles]pumps for bicycle tyresbicycle pumpspushchairsfold-up pushchairswheelchairstrolleysrescue sledstyres for vehicle wheelsrepair outfits for inner tubesphotography droneswater vehiclestreads for vehicles [roller belts]roof-mounted luggage racks for vehiclessafety seats for children, for vehicleselectrical anti-theft installations for vehicleselectric vehiclesvehicles for locomotion by land, water or railremote control vehicles, other than toys
Classe 14
Precious metalsboxes of precious metaljewellery boxesworks of art of precious metalnecklaces [jewellery, jewelry (Am.)]figurines [statuettes] of precious metaljewellerywristwatcheswatch strapsalarm clocks
Classe 15
Electronic musical instrumentspianosguitarsviolinshorns [musical instruments]musical instrumentsbags specially adapted for holding musical instrumentsmusical boxesmusic stands
Classe 16
Paperblack paperboard for photographylaser printing papertoilet papernapkin paperadvertisement boards of paper or cardboardstickerscalendarswriting paper padsenvelopesfigurines made from paperprinted publicationschildren's books incorporating electronic audible devicenewsletterspicturesbags [envelopes, pouches] of paper or plastics, for packaginggarbage bags of paper or of plasticsstapling presses [office requisites]office requisites, except furniturestationeryIndian inksstamps [seals]pensadhesive bands for stationery or household purposesdrawing instrumentsdrawing materialsinking ribbonsteaching materials [except apparatus]tailors' chalkarchitects' models
Classe 18
Leather, unworked or semi-workedbagstravelling trunksschool bagsgym bagssmall backpacksrucksackstrunks [luggage]all-purpose sports bagstrimmings of leather for furnitureleather thongsumbrellaswalking sticksclothing for pets
Classe 21
Containers for household or kitchen usecooking potsfrying pansdeep fryers, non-electricrice cooking pots [non-electric]cupsfood preserving jars of glassceramics for household purposesworks of art made of crystalthermos cupscoffee filters not of paper being part of non-electric coffee makersclothes racks, for drying / clothes drying hangerstoilet utensilstrash cansdrying racks for laundryheight adjustable ceiling-mounted drying racks for laundrytoothbrush holderscandle warmers, electric and non-electricaromatic oil diffusers, other than reed diffusers, electric and non-electriccombsbrushesmaterial for brush-makingwater apparatus for cleaning teeth and gumstoothbrushes, electricheads for electric toothbrushesmanual toothbrushestoothbrushestoothpickscosmetic utensilsthermally insulated containers for foodice cube trayscloth for washing floorsmopscleaning instruments, hand-operatedlint removers, electric or non-electricglass, unworked or semi-worked, except building glassanimal activated livestock waterersanimal-activated pet feedersanimal activated animal feedersindoor terrariums [vivariums]plug-in diffusers for mosquito repellentsultrasonic mosquito repellersultrasonic pest repellers
Classe 24
Fabricfiltering materials of textilefiltering clothsilk fabrics for printing patternsfeltface towels of textilebed linenquiltstablemats of textilecurtains of textilecurtains of textile or plasticfitted toilet lid covers of fabricmarabouts [cloth]banners of textile or plasticshroudshousehold linen
Classe 25
Tee-shirtssports jerseyssports vestssports singletslayettes [clothing]swimsuitsraincoatsmasquerade costumesshoessports shoescaps being headwearhosierygloves [clothing]riding glovesnecktiesscarfsgirdleswimplessashes for wearshower capssleep maskshairdressing capesclothingsports sweatbands
Classe 28
Gamesapparatus for gameselectronic games for the teaching of childrenvideo game interactive control floor pads or matsslides [playthings]building blocks, large sizesmart electronic toy vehiclestoy robotstoy modelssmart toysdrones [toys]toystoy vehiclesbaby gymsbattery operated toysplay sets for action figuresscooters [toys]building blocks [toys]remote-controlled toy vehiclescube-type puzzlesballs for gamesstationary exercise bicyclesexercise steppersrunning machinesbody-training apparatusbows for archerymachines for physical exercisesjump ropesskateboardshunting game callsswimming pools [play articles]protective paddings [parts of sports suits]gloves for gamesin-line roller skatesornaments for Christmas trees, except lights, candles and confectioneryrods for fishingtwirling batonscamouflage screens [sports articles]scratch cards for playing lottery gamesgrips for racketsgrip tapes for golf clubs
Classe 35
Advertisingpay per click advertisingonline advertising on a computer networkpresentation of goods on communication media, for retail purposesproviding business information via a web sitecommercial intermediation servicescommercial administration of the licensing of the goods and services of otherscommercial information and advice for consumers in the choice of products and servicesprovision of an on-line marketplace for buyers and sellers of goods and servicessales promotion for othersprocurement services for others [purchasing goods and services for other businesses]import-export agency servicesrecruitmentsearch engine optimization for sales promotionconducting data searches in computer files for otherscompiling indexes of information for commercial or advertising purposessponsorship searchrental of vending machinesrental of sales standsretail services for pharmaceutical, veterinary and sanitary preparations and medical supplies
Classe 36
Providing information relating to insurancefinancial managemente-wallet payment servicesjewellery appraisalreal estate agency servicesfinancial customs brokerage servicessurety servicescharitable fund raisingfiduciarylending against security
Classe 37
Providing construction informationbuilding of fair stalls and shopsupholsteringheating equipment installation and repairinstallation, maintenance and repair of computer hardwareinterference suppression in electrical apparatusmedical apparatus installation and repairmotor vehicle maintenance and repairairplane maintenance and repairshipbuildingphotographic apparatus repairclock and watch repairinstallation, changing, replacement and repair of locksre-tinningrepair of rubber tiresfurniture restorationcleaning of clothingsterilization of medical instrumentselevator installation and repairburglar alarm installation and repairtelephone repairpump repair and maintenanceparasol repairartificial snow-making servicesrestoration of works of arttuning of musical instrumentsrental of drainage pumpsswimming-pool maintenancerepair of power lineshand tool repairinstallation and repair of entertainment and sports equipmentsrental of dish washing machinesrepair of binocularsrepair of toys or dollsrepair of game machines and apparatusrepair and maintenance of smartphonestelephone installation and repaircell phone battery charging servicesrental of carpet cleaning machinesmaintenance and repair of mobile phonescleaning services for extractor hoodsmaintenance and repair of telescopesall the aforementioned services, are not related to underground oil well drilling services
Classe 38
News agency serviceswireless broadcastingmessage sendingproviding telecommunication channels for teleshopping servicescomputer aided transmission of messages and imagesproviding internet chatroomsproviding user access to global computer networksproviding online forumsvideo-on-demand transmissionteleconferencing servicesvideoconferencing servicescommunications by computer terminalstransmission of digital filesproviding access to databases
Classe 39
Transportation logisticsfreightingunloading cargopackaging of goodspilotinghaulingvehicle breakdown towing servicesfreight [shipping of goods]car transportreplenishment of vending machinesair transportcar rentalcar sharing serviceshorse rentalstoragerental of diving suitsdistribution of energyoperating canal lockscourier services [messages or merchandise]parcel deliverydelivery of goodstravel reservationtransport by pipelinerental of wheelchairslaunching of satellites for othersbottling servicespush-chair rental
Classe 41
Instruction servicescorrespondence coursesarranging and conducting of seminarsorganization of competitions [education or entertainment]lending library servicesproviding on-line electronic publications, not downloadableon-line publication of electronic books and journalsdistribution of video tapesproviding online videos, not downloadableproduction of radio and television programmesvideo productionentertainment servicesentertainer servicesgame services provided on-line from a computer networkhealth club services [health and fitness training]toy rentalgames equipment rentalconducting guided toursart exhibitionsanimal trainingmodelling for artistsorganization of lotteries [retailing of lottery tickets]rental of indoor aquariaoperating of lotteries [retailing of lottery tickets]all the aforementioned services are not related to the field of vocal music
Classe 42
Research and development of new products for otherstechnological researchquality system control and conformity assessmentproduct quality testing servicessurveyingmeteorological informationmaterial testingpackaging designdesign of telephonesdesign of interior decordress designingsoftware design and developmentresearch and development of computer softwareupdating and maintenance of computer softwarecloud computingplatform as a service [PaaS]software as a service [SaaS]consultancy in the design and development of computer hardwareproviding information on computer technology and programming via a web siteelectronic data storageauthenticating works of artgraphic arts designcloud seedinghandwriting analysis [graphology]cartography servicesrental of meters for the recording of energy consumption
Classe 42
certificação de sistema de qualidade
Classe 45
Monitoring of burglar and security alarmslifeguard servicesmonitoring of security systemschaperoningpersonal wardrobe styling consultancyfunerary undertakingopening of security locksonline social networking servicesfire-fightingorganization of religious meetingsadoption agency serviceslost property returnrental of safesgenealogical researchplanning and arranging of wedding ceremoniesreleasing doves for special occasionsdating servicesleasing of internet domain namesintellectual property consultancy